CAZyme Information: MGYG000001343_01752

Basic Information

• Species: Acinetobacter junii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter junii
• CAZyme ID: MGYG000001343_01752
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000001343_44|CGC1	41211.66	10.0733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001343	3338999	Isolate	not provided	not provided

• Gene Location: Start: 412242; End: 413351 Strand: -

Full Sequence      

MHSNSSSGSRPSLNSLSSKRPFQALALGFAILPFNSLNAEKSHQYNTVVTTKVLTVVAVE
NPTTVFKDGEFLHGFGYDLARNYAQSLNVKLDFKTVPDNTTALKWIAQGKANLAMTTANL
ATIESKQLVSFSASCGDQATLSKNGLNPQLNWVFKQADDPLTLTASGFVCQSKQSGTTQQ
LASFYNRNVVKPESWSTIQKDLNQRLPIYKASFKQSAAKYNLDWHLLAAIGYQESYLKPT
SVSPTGVRGLMMLTSSTAQAMGVTNRTDPIQSIQGGAKYYDLMLDQYENVPYPDRNWYAL
VAYNMGPGAVNQIQKRIKAQGKNPNQWVNLYDYLQRNQARNGRYKQALQYVTRIRTYLEH
LKTSNRIEV

Enzyme Prediction     

No EC number prediction in MGYG000001343_01752.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	221	363	4.9e-23	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	4.67e-64	213	363	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	5.32e-59	61	357	52	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	5.09e-49	150	357	209	427	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	1.05e-23	213	323	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.24e-19	226	312	3	87	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUY35880.1	2.17e-266	1	369	1	369
ATU45999.1	2.17e-266	1	369	1	369
QXR10025.1	2.17e-266	1	369	1	369
QXR28597.1	2.17e-266	1	369	1	369
QQV66960.1	2.17e-266	1	369	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	4.68e-42	158	336	206	387	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	5.32e-42	158	336	213	394	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	5.32e-42	158	336	213	394	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	9.84e-42	158	336	199	380	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	9.84e-42	158	336	199	380	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4VP14	6.94e-44	103	336	187	417	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mltF PE=3 SV=2
Q02RN8	2.73e-42	150	336	229	418	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=mltF PE=3 SV=2
A6V102	3.82e-41	158	336	238	419	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=mltF PE=3 SV=1
Q9HXN1	7.35e-41	158	336	238	419	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mltF PE=1 SV=2
Q1I5L3	4.85e-40	152	336	229	417	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas entomophila (strain L48) OX=384676 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.432472	0.562365	0.003460	0.001079	0.000336	0.000278

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001343_01752.