CAZyme Information: MGYG000001344_01337

Basic Information

• Species: Acinetobacter radioresistens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter radioresistens
• CAZyme ID: MGYG000001344_01337
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224	MGYG000001344_17|CGC3	26617.56	9.7754

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001344	3137190	Isolate	not provided	not provided

• Gene Location: Start: 275848; End: 276522 Strand: +

Full Sequence      

MKAIIVRTLLILVSLFLLVQLWIFSSLVWWRTHPVETTMFMRLDYWADRSQPIQHEWRDY
DQISDYFKHAIVAAEDGKFLQHHGFDWDGIQHAIERNGEKGQVVAGGSTISQQLAKNLFL
YNKRSFLRKGQEAIATWMMERMWTKQRILEVYMNSVEFGENIYGVEAATQHYFGKSSHSL
SREQAAFLAALLPNPKYYDENRNDRKLQYRKRMISKYMRYSHIP

Enzyme Prediction     

No EC number prediction in MGYG000001344_01337.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	54	218	8.7e-62	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02070	mono_pep_trsgly	9.47e-108	20	224	15	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK00056	mtgA	1.80e-104	19	224	19	229	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	8.22e-75	54	219	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	3.41e-71	33	219	52	241	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	4.94e-53	56	219	3	166	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV86945.1	4.88e-163	1	224	1	224
QMU06071.1	4.88e-163	1	224	1	224
QCS12892.1	4.88e-163	1	224	1	224
BBL21397.1	4.88e-163	1	224	1	224
QOW50374.1	4.73e-143	1	224	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.77e-32	61	214	26	184	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	6.98e-32	61	214	26	184	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	3.15e-27	63	199	47	183	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5ZZK_A	6.07e-26	61	201	63	209	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	7.36e-26	61	201	27	173	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7GXW9	5.46e-127	1	224	1	224	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain AB307-0294) OX=557600 GN=mtgA PE=3 SV=1
B2HVP6	5.46e-127	1	224	1	224	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain ACICU) OX=405416 GN=mtgA PE=3 SV=1
B0V9M4	5.46e-127	1	224	1	224	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain AYE) OX=509173 GN=mtgA PE=3 SV=1
B7I8R1	5.46e-127	1	224	1	224	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain AB0057) OX=480119 GN=mtgA PE=3 SV=1
B0VSQ2	7.75e-127	1	224	1	224	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain SDF) OX=509170 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997678	0.001004	0.000465	0.000004	0.000003	0.000872

TMHMM  Annotations     

start	end
9	31