CAZyme Information: MGYG000001344_01399

Basic Information

• Species: Acinetobacter radioresistens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter radioresistens
• CAZyme ID: MGYG000001344_01399
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1017	MGYG000001344_17|CGC4	109599.33	9.786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001344	3137190	Isolate	not provided	not provided

• Gene Location: Start: 341956; End: 345009 Strand: +

Full Sequence      

MYKPTTAVWQPSASILFKITLLGSAIAALGMTTGCSSTPANSKTIKSNQVGSGLLDASSL
DSLEDLLSATDMRAVEGDRLLILKHGDVWKRMTVGFKMDLNHWDSRIEAQRSWFISRQPY
LDRLSARASRYLYHTVKEAERRGLPTELALLPVIESSYDPAATSSAAAAGLWQFIPSTGK
IYGLKQTSLYDGRRDVVESTRAAYEFLGSLYNQFGSWELALAAYNAGPGRIQQAINRNRA
AGLPTDYWSLKLPQETMNYVPRFLAVAQIIKNPSAYGVSLPPIANRPHFREVNLNGGVGL
NQVSSITGLSRAELYALNPGHRGEYVDPASPMRILIPADLSPAIDTKLRSLNSGSGGLWA
SNQPPVASKPASSVSVQTRVTPAASATVPSSSSSSAPVLASNSSKTTTAKVSTPKGSDAL
ASFAAKADIPSAPRIPVAVTPAANITPVRVEPPISQTERDQILALVKAEGEKKSVEEVLQ
PQASQAEKDEVVAELKALAPQGTEIVDPYDGKIKLTAIQTSLSVAEQQGKEVKRGFSYPK
AVAENTLASSEELERNKGKDYIKTDSEIVVIPPKGKRSTYTVQPGDTLAVIAMKNGVSWR
DVAKWNQIDPSATLYVGTSLYLYDANPQKVEEKTVKASKPETYLVKANDSLTSVADQFGL
SLKQLADWNNLSVTSGLFVGQKLQLKDNPNAAVAKPVKVADTRVTAEQRIKTKSYTVKRG
EYLKMIAERYALSNQELADLTPGLTATSSLLVGQRINVPVEETSVSAKVETKEDKKTTLN
DNIKVSTNYKTESYKVQRGDTLTSIAAQSKVSVSELAQLNNINTGSGVRIGQTLKVPAGA
SMPDEYIVQPGDTLTSVAGKYHLQVNFLAGLNGLNRNSGLRVGQKIKLDGELPVSPAPVE
KETVTAKNSKNNSSGSHRDTERYTVKNGESLNTIASRVGISVKELAELNNLESRAGLLRG
QNLLIPKTVTSYTVKRGDTLIGLANKYGMNTSELAEMNDIQPSTQLRIGEVIKVPNL

Enzyme Prediction     

No EC number prediction in MGYG000001344_01399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	137	275	2.6e-24	0.8962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	1.40e-73	15	337	6	311	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	6.94e-58	140	268	2	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	1.80e-22	137	242	3	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK06347	PRK06347	2.04e-20	634	888	324	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	1.94e-18	712	965	330	591	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU06014.1	0.0	1	1017	1	1017
AWV86886.1	0.0	1	1017	1	1017
QCS12835.1	0.0	1	1017	1	1017
BBL21332.1	0.0	1	1017	1	1017
QER40049.1	0.0	1	970	1	973

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	7.45e-08	115	269	432	591	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	7.68e-08	115	269	461	620	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	1.70e-07	115	269	433	592	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	1.70e-07	115	269	432	591	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
4B8V_A	1.66e-06	794	967	44	218	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ8	1.97e-58	78	337	49	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P0AEZ7	1.97e-58	78	337	49	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P32820	9.74e-28	125	287	19	178	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
P37710	4.57e-17	575	888	426	736	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	2.54e-15	579	967	256	666	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000140	0.004541	0.995336	0.000020	0.000005	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001344_01399.