CAZyme Information: MGYG000001344_02768

Basic Information

• Species: Acinetobacter radioresistens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter radioresistens
• CAZyme ID: MGYG000001344_02768
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283	MGYG000001344_18|CGC2	30808.52	9.9068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001344	3137190	Isolate	not provided	not provided

• Gene Location: Start: 820580; End: 821431 Strand: +

Full Sequence      

MKTYFDISRLGIWGCAVLVLTSSYSSAGQMYVYKDQSGSTLLTNRKMNDSSLKKVKVTYY
PESNIHSYSNWGKSEAAVLPSYSKNRDAFDHIIKQAAQQHGVSEGLIKAVMHTESGFNVN
ARSPVGAQGLMQLMPATARRFNVSNAYDPYQNILGGAKYLSWLLKRFKGNTHLALAAYNA
GEGNVAKYGGIPPFRETQDYVRRVTSRYSNLYSGGALNLTASNNPENGLLVQETVNSAAN
TQAAGRSYAPRQIITLADGSYTDAPGTYVSSNATASARIHISN

Enzyme Prediction     

No EC number prediction in MGYG000001344_02768.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	105	213	7.4e-34	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.24e-52	104	208	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.36e-44	88	206	5	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.72e-41	92	208	7	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	7.48e-39	93	208	1	156	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.79e-36	93	200	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL20087.1	4.72e-204	1	283	1	283
QCS11690.1	4.72e-204	1	283	1	283
AWV85722.1	2.73e-203	1	283	1	283
QMU06844.1	3.41e-181	30	283	1	254
QLB58842.1	8.57e-135	1	283	1	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	4.79e-14	18	204	345	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.80e-14	18	204	349	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.83e-14	18	204	355	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	4.84e-14	18	204	359	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	4.86e-14	18	204	365	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.26e-43	60	208	21	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	1.23e-41	65	221	1401	1554	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.23e-41	65	221	1401	1554	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	9.23e-17	93	236	11	149	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q3IHZ1	3.11e-13	106	185	296	381	Membrane-bound lytic murein transglycosylase F OS=Pseudoalteromonas translucida (strain TAC 125) OX=326442 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.043206	0.581499	0.373773	0.000610	0.000389	0.000500

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001344_02768.