CAZyme Information: MGYG000001344_02899

Basic Information

• Species: Acinetobacter radioresistens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter radioresistens
• CAZyme ID: MGYG000001344_02899
• CAZy Family: GT4
• CAZyme Description: Glutamate/aspartate import solute-binding protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000001344_18|CGC3	34920.62	8.7472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001344	3137190	Isolate	not provided	not provided

• Gene Location: Start: 956948; End: 957910 Strand: +

Full Sequence      

MSNKVRAASVLCLSTLMLGLVACSNNNNAPASENNAASGNAANTGSAGSGTLEKIRQSGT
VVLGHRDSSIPFSYIADNPNQPVGYAHDLQMKVVEALKQKLNKPDLKVRYNLVTSQNRIP
LVSNGTVDLECGSTTNNKERQQQVDFSVGFFQVGSRLLTAKDSGIKDFSDLKGKKVVTTA
GTTSERYIRQHAQELGIGEVISAKDHADSFLMLQNGRAAAFMMDDILLAGEKSKAKEPDK
WVIVGTPPIQEVYGCMLRKGDKEFKQVVDDAIKATYASGEINDMYKKWFQQPIPPKNINL
NFPMSEQVKALISNPHDRDQ

Enzyme Prediction     

No EC number prediction in MGYG000001344_02899.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10797	PRK10797	7.34e-131	11	318	6	299	glutamate and aspartate transporter subunit; Provisional
cd13688	PBP2_GltI_DEBP	2.98e-110	52	289	1	238	Substrate-binding domain of ABC aspartate-glutamate transporter; the type 2 periplasmic binding protein fold. This subfamily represents the periplasmic-binding protein component of ABC transporter specific for carboxylic amino acids, including GtlI from Escherichia coli. The aspartate-glutamate binding domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
cd01000	PBP2_Cys_DEBP_like	3.41e-73	52	289	1	228	Substrate-binding domain of cysteine- and aspartate/glutamate-binding proteins; the type 2 periplasmic-binding protein fold. This family comprises of the periplasmic-binding protein component of ABC transporters specific for cysteine and carboxylic amino acids, as well as their closely related proteins. The cysteine and aspartate-glutamate binding domains belong to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
cd13689	PBP2_BsGlnH	7.42e-71	52	289	1	228	Substrate binding domain of ABC glutamine transporter from Bacillus subtilis; the type 2 periplasmic-bindig protein fold. This group includes periplasmic glutamine-binding domain GlnP from Bacillus subtilis and its related proteins. The GlnP domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
pfam00497	SBP_bac_3	9.65e-62	61	291	1	225	Bacterial extracellular solute-binding proteins, family 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXX81055.1	3.61e-104	50	318	26	294
QWJ92671.1	1.03e-103	50	318	26	294
QLQ94799.1	1.03e-103	50	318	26	294
VEH54506.1	1.03e-103	50	318	26	294
VEB67078.1	1.03e-103	50	318	26	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VHA_A	8.18e-107	51	318	9	276	DEBP[Shigella flexneri],2VHA_B DEBP [Shigella flexneri]
2IA4_A	1.01e-102	51	318	9	276	Crystalstructure of Novel amino acid binding protein from Shigella flexneri [Shigella flexneri 2a str. 301],2IA4_B Crystal structure of Novel amino acid binding protein from Shigella flexneri [Shigella flexneri 2a str. 301]
5EYF_A	3.55e-29	93	289	45	236	CrystalStructure of Solute-binding Protein from Enterococcus faecium with Bound Glutamate [Enterococcus faecium DO],5EYF_B Crystal Structure of Solute-binding Protein from Enterococcus faecium with Bound Glutamate [Enterococcus faecium DO]
4ZV1_A	7.93e-25	59	289	10	231	Anancestral arginine-binding protein bound to arginine [synthetic construct],4ZV2_A An ancestral arginine-binding protein bound to glutamine [synthetic construct]
4YMX_A	3.47e-21	51	291	29	260	ChainA, ABC-type amino acid transport system, periplasmic component [Caldanaerobacter subterraneus subsp. tengcongensis MB4],4YMX_B Chain B, ABC-type amino acid transport system, periplasmic component [Caldanaerobacter subterraneus subsp. tengcongensis MB4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9I402	2.91e-132	50	318	28	297	L-glutamate/L-aspartate-binding protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1342 PE=1 SV=1
Q9ZF60	6.44e-107	51	318	32	299	Glutamate/aspartate import solute-binding protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=gltI PE=3 SV=3
P37902	3.44e-104	51	318	32	299	Glutamate/aspartate import solute-binding protein OS=Escherichia coli (strain K12) OX=83333 GN=gltI PE=1 SV=2
O34563	3.61e-28	51	291	38	269	ABC transporter glutamine-binding protein GlnH OS=Bacillus subtilis (strain 168) OX=224308 GN=glnH PE=2 SV=1
P27676	4.12e-24	46	264	46	255	Glutamine-binding protein OS=Geobacillus stearothermophilus OX=1422 GN=glnH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000005	1.000066	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001344_02899.