CAZyme Information: MGYG000001345_01163

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_01163
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738	MGYG000001345_32|CGC5	85521.19	8.7035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 256983; End: 259199 Strand: +

Full Sequence      

MNELKKLVCILLSLIGMHTIQAEIITYPAEVTPGSWLCFRKEISVEKDASHNLLKIAADS
KYWLWINGELVVREGGLKRGPNPKDTYCDILQDVKGLVPGKNTIALLVWYFGKEGFSHRN
SPTAGISVDLTIGKQRYISDDSWKVSIHPSFYIPKGIKPNFRLPESNIGFDAEKKVAFWD
KDFDDTQWKNVKVIKKELSGWGQLVERPIPMWKDYGLKDYVKVERKSDTLLVAYLPYNAQ
VNPYIKLKAKAGRLIDIRTDNYRGGGTPNVYAEYITKSGIQEFEAWGWMNGHQVLYTIPK
DVEVLELKFRETGYDTELAGSFSCEKQFYNKLWNKSLRTLYITMRDTYMDCPDRERAQWW
GDVVNELGEAFYSLDQNAHLLTRKAILELMNWQRPDSTIFAPIPAGNWNQELPMQMLASV
GYYGFWTYYMGTGDKNTIKAVYPNVKKYIHVWKLDEEGLVVPRKGGWTWGDWGDNKDLVL
LYNLWYSLALEGFHLMADLLGEKEDSRWACQVNERLKRAFHTKYWNGTFYLSPHYKGKPD
DRAQALAVVAGVLPESEYSVIRPFFKQQYHSSPYMEKYVLEALCVMGYYEDALDRMKKRY
HDMVESELTTLWEGWGIGNKGFGGGSYNHAWSGGPLTILSQYFAGISPMKPAFKEFAIKP
AWNCFEHIQSVTPTQWGEIELNITNESDMIVMKVKIPRNTKGYFYIPDRIKRYRINGKEK
INKKREILKKGIWDIELY

Enzyme Prediction     

No EC number prediction in MGYG000001345_01163.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	257	702	8.5e-84	0.8988095238095238
CBM67	25	195	8.4e-28	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.51e-28	319	642	3	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.48e-07	645	721	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	5.15e-04	412	664	321	626	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam04685	DUF608	0.001	426	530	109	216	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH54696.1	0.0	1	738	1	739
QNL36670.1	0.0	1	738	1	739
QLG44645.1	1.52e-268	32	718	37	729
AGY53286.1	7.95e-262	21	718	27	734
ASB50049.1	1.53e-259	16	707	19	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.34e-28	294	709	276	697	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6I60_A	2.40e-27	39	713	179	905	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
2OKX_A	3.97e-07	34	210	21	196	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.35e-14	28	702	176	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000231	0.999062	0.000178	0.000172	0.000153	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_01163.