CAZyme Information: MGYG000001345_01164

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_01164
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765	MGYG000001345_32|CGC5	87676.96	7.3435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 259178; End: 261475 Strand: +

Full Sequence      

MGHRIILTVILLSFTICSFGDNIFNGAQWISVSESQNTPNQWFCFRKQVECERKHSIAEL
NIAVDSKYWLWVNDSLVTFEGGLKRGPNPLDTYYDCVDISRFLKKGLNIIAIQVWFWGKD
GYCHKNSGRAGLLVDLRLGKKERVLSDKSWKVKVHPAYGESSLPHPNYRLPEANVHFDAR
KDIEGWQSLDYEDQLWGYATACGEYPCLPWNKVHLRPFPNWKDSGIIRYDSLKTDEAGKI
VGFLPKNISITPYLKIKADAGKLIDIRTDNYKGGSEYNVRAEYITKEGVQSFEAFNYMNG
HSVVYSIPQEVEVIELGYRETRFNTELEGSFVCEDEFYNRLWCKALNTMNLNMRDAIQDP
DRERSQWWGDAVIVSGEIFYACDLNGKLLVKKAIKNLVDWQKDDGVLYSPVPAGSWDKEL
PVQMLASVGKYGIWNYYVYTGDSATIKEAYPAVRKYLSLWKLDERNLVKHRTGGWDWSDW
GQDIDVCVLDNAWYSLALEGLANMATLLGDQLIAEDCLFKMKKVREAVNKYYWNGRLYRN
PFYNGRTDDRANALAVLAGFATENQWKTIQEYLSNYQAASPYMEKYILEAFFCKGDIKGG
LQRMKNRYQYMVNHRLTTLWEDWNIGGAGGGSINHGWAGGPLSLLSQYVAGIAPLTAGWK
TFMIRPSDVLFKKIKCSVPLGQGVVVLNMDAYQRKINVDCDVNQNFILAVPRTWFKGASL
CILNGKEYDIQELKGIQNKKISFDSEDTQSFYFKIVDQSVQIHII

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	277	702	9.7e-77	0.871031746031746
CBM67	27	210	3.5e-41	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.08e-27	329	649	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.36e-07	93	219	42	156	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam06202	GDE_C	0.003	431	570	91	257	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam04685	DUF608	0.006	433	540	108	218	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
pfam17167	Glyco_hydro_36	0.006	496	599	210	332	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTN32968.1	1.65e-252	40	685	207	858
QDH54696.1	8.88e-239	38	698	32	689
ACU03186.1	1.87e-235	13	681	20	693
QLG44645.1	7.35e-235	27	712	26	709
QNL36670.1	7.51e-235	38	727	32	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	8.26e-15	94	666	356	947	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.33e-16	46	666	178	831	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	4.50e-14	94	666	356	947	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000486	0.998136	0.000874	0.000180	0.000147	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_01164.