CAZyme Information: MGYG000001345_01538

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_01538
• CAZy Family: GH31
• CAZyme Description: Oligosaccharide 4-alpha-D-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
714	MGYG000001345_33|CGC5	79943.97	6.8213

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 307211; End: 309355 Strand: +

Full Sequence      

MRKRISLLQMAVFFFTAQVAWAGNIKTEKVTLVGNGIVEFIPVGYDVSRTPSLILSHEPE
KKGGVPENWKLVPQFTMTDGKANASLDVPAGTSLYGGGEVTGPLLRNGQKIKMWNTDNGM
YRVDGGSRLYQTHPWVLGVRPDGTAFGVLFDSFWKAELITNSDKIEFNTEGAPFRTYIID
RESPQAVLKGLAELTGTISMPPRWAIGYHQSRFSYVPEARVKEVANTFREKKIPCDVIWF
DINYMDEFRVFTINNRDFPDPKRMNKYLHDNGFHSVYMIDPGVKVDDNYFVYKTGKEQNA
FVCDIYRNEFHGKVWPGACAFPDFTRPETRTWWSGLYKDFMANGIDGIWNDMNEPSVFDG
PGGTMPENNIHLGGGNLPIGSHLMYHNAYGRLMVEASYNGMMAANPSKRPFLLSRSNIIG
GQRYAAMWTGDNEATYEQMKLSVPMSITLGLSGQPFNGPDIGGFAGNTTPDLWGNWLGFG
AFFPFSRGHASCDTNNKEPWAFTKDIEKESRMALERRYRLLPYLYTAFHVAHKDGQPVMA
PVFFADPKDESLRAEEQAFMLGTDLLIIPAFAKNPSLPKGIWENLSLVKGDTKGKYQAKL
KVRGGSIIPVGKIIQNVNENSFDPLTLVVCPDEDGKAEGSLYWDKGDGWGFQKGDYKQLT
FKAELVDGHHLIVKVTEDKGEDQIDFGMIKVEVLHAGHTYKSSGDIAKGITVKL

Enzyme Prediction     

EC	3.2.1.20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	177	601	1.5e-136	0.9672131147540983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02763	PLN02763	0.0	58	680	43	666	hydrolase, hydrolyzing O-glycosyl compounds
cd06604	GH31_glucosidase_II_MalA	0.0	196	535	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
pfam01055	Glyco_hydro_31	0.0	177	608	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	2.82e-169	196	647	1	466	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
COG1501	YicI	9.33e-150	85	681	146	739	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ48926.1	0.0	1	714	1	714
QRQ55740.1	0.0	1	714	1	714
SCV08346.1	0.0	1	714	1	714
QRM98559.1	0.0	1	714	1	714
QDH54460.1	0.0	1	714	1	714

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJW_A	0.0	32	714	2	684	Crystalstructure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5DJW_B Crystal structure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5F0E_A	7.70e-102	16	697	93	811	Murineendoplasmic reticulum alpha-glucosidase II [Mus musculus],5H9O_A Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5H9O_C Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5HJO_A Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJO_C Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJR_A Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus],5HJR_C Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus]
7KBJ_A	8.86e-102	160	697	1	551	ChainA, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7KBJ_C Chain C, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7KBR_A Chain A, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7KBR_C Chain C, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7L9E_A Chain A, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7L9E_C Chain C, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus]
5IEF_A	1.27e-99	108	697	242	866	Murineendoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	1.30e-99	108	697	242	866	Murineendoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	3.19e-137	95	683	150	746	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9FN05	4.62e-108	102	661	243	833	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
B9F676	7.38e-102	102	661	246	831	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
Q8BVW0	3.67e-100	106	680	225	834	Neutral alpha-glucosidase C OS=Mus musculus OX=10090 GN=Ganc PE=1 SV=2
Q8BHN3	1.25e-98	108	697	274	898	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000291	0.999031	0.000191	0.000163	0.000153	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_01538.