CAZyme Information: MGYG000001345_01573

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_01573
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546	MGYG000001345_33|CGC8	60353.38	5.1889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 368752; End: 370392 Strand: +

Full Sequence      

MKMDIILSKWCLAILFAFGILACTDGSDANELPKEPEGTGETQDEKIPAFPGAEGHGRYT
TGGRGGDVYIVTSLEDKLQNGTLRYGIEKLSGKRTIIFQVSGTIHLNGDLKIKNGDLTIA
GQTAPGDGICLAGYPVFLEADNVIVRFMRFRMGNKEDVSADGADAFGGRYHRNIMIDHCS
MSWCTDECVSFYQNENFTLQWCLISESLRLGGHTKGPHGYGGIWGGMKASFHHNLLAHHD
SRNPRLGPGVNSTKENEIVDMRNNVIYNWCGNSCYGGEAMHVNIVNNFYKPGPATPTGTS
KRGRIIAIDKKVSDSDKKSYPAIFDTWGDFFIQGNVVDDGQINGAADYDRCMKATKDNWE
YGVYNQFDKKYGTLDEGTKKALKRTTPVETGTVTTHDARTAFERVMDYAGCSLHRDRVDE
RIVQETRTGTANYQGMNEHNGQGVVEGIDWKSVGYPKKGIIDSQDDVIPVGESSAWPELV
QGVILKDSDNDGMPDEWEKKYGLNPNDASDRNGKTVDEEGTYTNLEMYMNSLVQKIVEEQ
NKGGVQ

Enzyme Prediction     

No EC number prediction in MGYG000001345_01573.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	101	289	3.8e-80	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	5.31e-08	112	307	13	181	Amb_all domain.
COG3866	PelB	7.26e-06	79	246	60	236	Pectate lyase [Carbohydrate transport and metabolism].
pfam18884	TSP3_bac	0.001	487	508	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH54489.1	0.0	1	546	1	546
QUT27351.1	0.0	1	546	1	546
QRM98529.1	0.0	1	546	1	546
CBK68207.1	0.0	1	546	1	546
QUT32882.1	0.0	1	546	1	546

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	1.05e-42	47	533	20	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	1.33e-40	47	533	20	414	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q5B297	6.50e-39	49	533	22	411	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
Q4WL88	4.34e-38	47	533	21	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	5.98e-38	47	533	21	415	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000128	0.091587	0.908181	0.000040	0.000045	0.000040

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_01573.