CAZyme Information: MGYG000001345_01574

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_01574
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	MGYG000001345_33|CGC8	57746.44	7.046

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 370434; End: 372011 Strand: +

Full Sequence      

MNLIFRCLTVLLTLIGNEAAFASSGIGNTLDFGELAAFPGAEGYGRMTTGGRGGEVYIVT
SLADDGMPGTLRYGIEKLDGPRTIIFQVSGTIFLHKDLKIRKGNLTIAGQTAPGNGICIA
GYPVTNYASNVILRFLRFRMGNKECVHPDGADALGGKGARNVIIDHCSISWCTDECASFY
ENDDFTMQWCIISESLRLGGHTKGPHGYGGIWGGEHSSYHHNLLAHHDSRNPRFGLGAKV
RKNGECDGDYVDFRNNVIYNWGMNSSYGGERMNINIVNNYYKPGPATVTGSKRGRIFAID
ATENRNGGYLWGKYYIDGNVVDGGADDKNSQKATANNWEYGVYNQFSNNYKKVVTQKTKD
SIRLDKPHEFASVTTHSAFNAYKQVLDYAGCSLHRDDVDARIVKETRTRTAGYKGLNVHN
GEGGIWKSEGYPKPGLIDSQDDLLSLNTSENVSAWPVLLQRSTLIDSDNDGLPDAWERKF
GLNPHDASDGNGKTIDKYGQYTNLEMYMNSLVHDIIEKQNSGGKK

Enzyme Prediction     

No EC number prediction in MGYG000001345_01574.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	89	281	1.1e-78	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	2.23e-06	102	281	15	186	Amb_all domain.
COG3866	PelB	1.38e-04	80	281	73	273	Pectate lyase [Carbohydrate transport and metabolism].
pfam18884	TSP3_bac	0.007	466	487	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH54490.1	0.0	1	525	1	525
QUT27352.1	0.0	1	525	1	525
QQR18633.1	0.0	1	525	1	525
CBK68208.1	0.0	1	525	3	527
ANU59633.1	0.0	1	525	1	525

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PXZ_A	9.29e-09	41	174	25	173	ChainA, Major pollen allergen Jun a 1 [Juniperus ashei],1PXZ_B Chain B, Major pollen allergen Jun a 1 [Juniperus ashei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	7.64e-44	35	512	20	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
B0XMA2	5.33e-42	35	512	21	415	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	1.41e-41	35	512	21	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
Q2UB83	1.91e-41	35	512	20	414	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q5B297	3.64e-40	35	512	20	411	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.999056	0.000191	0.000162	0.000154	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_01574.