CAZyme Information: MGYG000001345_01616

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_01616
• CAZy Family: PL11
• CAZyme Description: Rhamnogalacturonan exolyase YesX

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000001345_33|CGC11	34474.84	6.7545

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 446291; End: 447202 Strand: -

Full Sequence      

MCRGYYTRTVLAAFDWNGKELKNRWVFDSNHPGCEQYAGQGNHNLRVGDVDGDGCDEIIY
GSCAIDHNGKGLYSTRMGHGDAIHLTHFDPSRKGLQVWDCHENKRDGSTYRDAATGEVLL
QIKSNTDVGRCMAADIDPTHPGVEMWSGDSQGIRNVKGEIIAPKMRNMPTNMAVWWDGDL
LRELLDRNMIIKYDWENKKFVPLVKFTGTLFNNGTKSNPCLQGDIIGDWREEVLVRSENN
AALRLYVSTIPTEYRFHTFLEEPIYRISIATQNVGYNQPTQPGFYFGPDLIKMKGTFRGY
QFK

Enzyme Prediction     

No EC number prediction in MGYG000001345_01616.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	1	291	6.9e-135	0.49914236706689535

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	3.02e-168	1	284	281	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK68250.1	8.60e-235	1	303	319	621
QUT32929.1	1.31e-234	1	303	331	633
QDH54539.1	1.31e-234	1	303	331	633
QUT27396.1	1.51e-233	1	303	331	633
QRQ55839.1	2.03e-231	1	303	331	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CAG_A	1.04e-105	1	290	291	579	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2ZUY_A	3.09e-104	1	292	288	595	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]
2Z8R_A	9.00e-103	1	292	284	574	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31527	1.37e-103	1	292	288	595	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1
O31526	1.05e-101	1	292	321	611	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_01616.