CAZyme Information: MGYG000001345_01896

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_01896
• CAZy Family: GH28
• CAZyme Description: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640		71249.26	6.6369

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 286660; End: 288582 Strand: +

Full Sequence      

MKGRLLIVIFISICFIAGSCNVSSVQGSRYNFSSLDSVIQGWVSKEYYPGASICVVKNDS
VIFQKNYGSYTPDTKVYVASAGKWVAAAVIGAVVDSTSLDWDDPVEKWLPEFKGDAKGKI
LLRQLLSHTSGVRPYLPEPRVDNYNHLDSAIIEILPLDTVFTSGSRFQYGGLAMQIAGRM
AEVAMGKEFETLFQELLAQPLEMKNSHFTPINTDGGHAPMLGGGLCTTLNDYIHFLSMIY
HDGMYNDKRIISAKTVKEMQADQVKDAIIPSNNSDNYVAKGLGQSHNGIYGLGEWRELID
KKTGEAYQISSPGWAGAYPWINKRENVYGFFIAHVVGASSKEDGFSSFYGSPVISRTVSE
IVKGHPLVVKQGRVEVGNGSLYYEEAGTGAPVIFVHGHSLDHRMWDEQFSVLAKKYRVIR
YDLRGYGISSSQTEDYQFTHAGDLVTLMDSLHIKKAHIVGLSLGGFITADMLAYFPDRML
SAFLASGNIRKSKGPSEPMTPEEARVRDKEIAALKEKGVDVMKKEWFEGLMKSGGSQRER
MRESLWQMIDEWDAWQPLHKEVRVVAGLDAIEKLKKNHPDVPALIVEGHSSGNRFSKEPP
ILQYLPNGKLKVIDDCGHMLNMERPEEFNAALEEFLKNVQ

Enzyme Prediction     

No EC number prediction in MGYG000001345_01896.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0596	MhpC	1.11e-35	374	639	5	282	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].
pfam00144	Beta-lactamase	2.42e-33	35	327	1	300	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
TIGR02427	protocat_pcaD	1.32e-29	381	637	2	251	3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other]
COG1680	AmpC	4.89e-27	4	328	8	356	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].
PRK14875	PRK14875	2.00e-20	373	639	113	371	acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT92203.1	9.80e-150	362	637	511	786
ALJ62047.1	1.95e-149	362	637	511	786
BBM69122.1	1.27e-17	35	257	606	864
BBM72115.1	1.27e-17	35	257	606	864
QXD14887.1	1.68e-17	35	257	600	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TGF_A	5.43e-183	24	362	2	337	ChainA, Uncharacterized protein [Phocaeicola dorei DSM 17855],5TGF_B Chain B, Uncharacterized protein [Phocaeicola dorei DSM 17855],5TGF_C Chain C, Uncharacterized protein [Phocaeicola dorei DSM 17855],5TGF_D Chain D, Uncharacterized protein [Phocaeicola dorei DSM 17855]
5EGN_A	2.39e-19	374	636	4	260	Est816as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_B Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_C Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_D Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_E Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_F Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_G Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_H Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium]
3FOB_A	7.02e-19	381	638	19	281	Crystalstructure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames],3FOB_B Crystal structure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames],3FOB_C Crystal structure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames]
1HKH_A	2.04e-16	372	486	1	124	unligatedgamma lactamase from an Aureobacterium species [Microbacterium],1HKH_B unligated gamma lactamase from an Aureobacterium species [Microbacterium],1HL7_A Gamma lactamase from an Aureobacterium species in complex with 3a,4,7,7a-tetrahydro-benzo [1,3] dioxol-2-one [Microbacterium sp.],1HL7_B Gamma lactamase from an Aureobacterium species in complex with 3a,4,7,7a-tetrahydro-benzo [1,3] dioxol-2-one [Microbacterium sp.]
4IQ4_A	2.61e-16	381	640	16	280	Structureof a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4IQ4_B Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4IQ4_C Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4IQ4_D Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4IQ4_E Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4IQ4_F Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4ITV_A Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_B Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_C Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_D Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_E Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_F Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_G Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_H Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_I Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_J Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_K Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_L Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4IVJ_A Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, I222 form [Kitasatospora aureofaciens],4IVJ_B Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, I222 form [Kitasatospora aureofaciens],4IVJ_C Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, I222 form [Kitasatospora aureofaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q55921	7.16e-17	381	637	16	276	Putative non-heme chloroperoxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr0314 PE=3 SV=1
P29715	1.49e-15	381	636	16	276	Non-haem bromoperoxidase BPO-A2 OS=Kitasatospora aureofaciens OX=1894 GN=bpoA2 PE=1 SV=3
O31168	6.63e-15	381	636	16	276	Non-heme chloroperoxidase OS=Kitasatospora aureofaciens OX=1894 GN=cpo PE=1 SV=1
P33912	6.93e-14	381	636	12	273	Non-heme chloroperoxidase CPO-A1 OS=Kitasatospora aureofaciens OX=1894 GN=bpoA1 PE=1 SV=3
Q59093	1.49e-13	392	640	30	266	3-oxoadipate enol-lactonase 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=pcaD PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000334	0.290653	0.708670	0.000119	0.000117	0.000108

TMHMM  Annotations     

start	end
5	27