CAZyme Information: MGYG000001345_01913

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_01913
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000001345_34|CGC6	46118.32	6.085

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 319828; End: 321048 Strand: +

Full Sequence      

MKKIVVGLAVMLGFCTCVHQPSGTLDVNKALDYCAEQTQRTLAELKTDSGIDYTMMPRNI
MTDEHHWNCRKATKEEWCAGFWPGVLWYDYEYTKDKQIQEEAEKFTNSLEFLSRTPAFDH
DLGFLVFCSYGNGYRLTKNPAYKQVILDTADTLATLFNPIVGTILSWPREVEPRNWPHNT
IMDNMINLEMLFWAAKNGGNPYLYDIAVSHADKTMKCQFRPDYTSYHVAVYDTITGNLIK
GVTHQGYADSTMWARGQAWAIYGYTVVYRETKDPKYLDFAQKVTDVYLERLPEDKVPYWD
FSAPGIPDAPRDASAAAVVASALLELSTYLPNGTGKRYKDAAIEMLASLNSDSYRSGKSK
PSFLLHSVGHWPAHSEIDASIIYADYYYIEALLRLKRLQEGHGVLG

Enzyme Prediction     

No EC number prediction in MGYG000001345_01913.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	71	395	2.3e-127	0.9908814589665653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	6.79e-12	54	300	8	240	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT28605.1	7.92e-315	1	406	1	406
CBK69065.1	3.23e-314	1	406	1	406
QUR43675.1	3.77e-313	1	406	1	406
QDH55123.1	3.77e-313	1	406	1	406
QRM97784.1	5.35e-313	1	406	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.49e-94	32	400	30	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	5.04e-62	76	402	41	371	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	2.76e-61	76	402	41	371	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	8.13e-58	76	397	67	391	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	8.33e-58	76	397	68	392	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	6.80e-95	71	398	71	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9RC92	2.76e-61	76	402	41	371	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	5.29e-60	26	397	29	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8DR77	3.09e-57	76	397	66	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	4.56e-57	76	397	68	392	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000452	0.142273	0.857064	0.000077	0.000087	0.000068

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_01913.