CAZyme Information: MGYG000001345_01930

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_01930
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813	MGYG000001345_34|CGC7	91231.74	7.5235

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 337294; End: 339735 Strand: -

Full Sequence      

MNPIKFFKRLSVTKKVMTISITLLIIGYIFCLPRQLFHVPYSTVVTDRNEELLGARIASD
GQWRFPPRKTTPEKIKQCLITFEDKHFYHHWGVNPLATGRALYQNLKNKRVVSGGSTLTM
QTIRLARNKPRTLGEKVVEMIWATRLEFRASKEEILSMYVSHAPFGGNVVGLDAAAWRYF
GHSAEDLSWAESAMLAVLPNAPAMIHLSKGRKTLLSKRNRLLKQLLEEEIIDASTYELAV
SEPLPDEPHPLPQIAPHLVSRFYQERNGLYTRSTIDRGIQSHIESLAERWSNEFNRSDIR
NLAILVIDIPTNQVVAYCGNVHFDRKQGGSQVDVIQAPRSTGSILKPFLYNAMLQEGSLL
PKMLLPDVPVNINGFTPQNFSMQFEGAVPASEALARSLNIPAVTMLQRYGVPKFHHLLQQ
MEFKTINRTASHYGLSLILGGAEATLWDVTNAYAQMGRSLSSSPSPTVSQGKEAQILLET
ENTEQINNDTKQTSRNHKSNHNKQEKREQSNSSPLSVEEDSEETTSAKTGAAWLTLSALT
EVNRPEEIDWKSIPSMQTIAWKTGTSYGFRDAWAVGVTPRYTVGVWVGNATGEGKPGLVG
AQTAGPVLFDIFSYLPSSPWFERPTGVFVDAEICRQSGHLKGRFCEETDTVLILPAGLRT
EACPYHHLVTLSADESHRIYENCANTEPTIQKSWFALPPVWEWYYKQHHPEYKPLPPFKA
GCGEDSFQSMQFIYPPMNAHIKLPKQLDGSKGFLTVELAHSNPNATIFWHLDDTYQTQTQ
DFHKISLQPAPGKHSLTAVDGEGNTVSTTFFIE

Enzyme Prediction     

No EC number prediction in MGYG000001345_01930.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	68	225	4.8e-46	0.8926553672316384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	0.0	33	813	2	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	0.0	18	813	11	732	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	3.63e-123	59	638	57	592	penicillin-binding protein 1C; Provisional
TIGR02074	PBP_1a_fam	2.63e-94	72	614	11	527	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.71e-93	39	632	52	613	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT28622.1	0.0	1	813	1	813
CBK69080.1	0.0	1	813	1	813
QUT22846.1	0.0	1	813	1	814
QRN02044.1	0.0	17	813	1	797
QUR46630.1	0.0	17	813	1	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	2.02e-30	65	464	158	579	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.15e-30	65	464	179	600	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
2OQO_A	5.17e-30	72	242	29	200	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.78e-29	72	242	29	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3FWL_A	4.24e-28	65	464	162	583	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	3.08e-94	33	627	33	580	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
Q9KUC0	1.22e-38	59	641	176	741	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
P40750	5.59e-37	47	591	60	599	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
O66874	2.60e-31	72	610	72	662	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q89AR2	8.55e-31	65	589	159	667	Penicillin-binding protein 1B OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) OX=224915 GN=mrcB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_01930.