CAZyme Information: MGYG000001345_01954

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_01954
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	MGYG000001345_34|CGC9	86338.13	7.0489

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 367807; End: 370122 Strand: -

Full Sequence      

MKIKLLFILLITFQPLVFGANDIPERPLYLDPSQSVQTRVENLMSLMTLKEKVAQMCQYV
GLEHMRDAEKNITEEELLNGHARGFYKGLHSTGVERMVTQGEIGSFLHVLTPAEANHLQK
LAEKSRLKIPLLIGIDAIHGNGLVSGSTIYPSPIGMASTFAPDLIEQASRQTALEMRVTG
SHWAFTPNIEIACDARWGRVGETFGEDPYLVSRMGVASIKGLQTDNLTGLNTVLACAKHL
VAGGIANNGTNAGPVELSEGKLRNFFLPPFKAAIQEAKPFTLMPAHNELNGIPCHANKWL
MTDIMRNEYGFDGFIVSDWMDMEAISTRHRISENTTDAFFLSVDGGVDMHMHGPVFFDAI
LKLIKEGKLTEERVNKACAKILEAKFRLGLFENRYVTEAGIKKTVFTKKHQQTALEIARR
SIVLLKNESLLPVDTRKFKKILVTGPNANNQSIMGDWVFEQPEKNVSTILEGIKEEASGT
QINYVDVGWNMRALDSAKIEEAIQTAKSSDLAIVIVGEDSFRQHWKEKTCGENRDRMDIT
LWGKQDYLVESIYKTGVPTIVILINGRPLATRWIAENIPAVIEAWEPGSMGGKAIAEILF
GKVNPSGKLPITIPRHVGQISTVYNHKPSQFLHPYIDGDKTPLYPFGYGLSYTSFKYDQL
KVNKADYHANEEIEITVNVSNTGERQGEEVVQLYIRDDYSNTTRPVKELKRFQRILLEKG
ENKVVSFRLNKEDLSYYNHKAEYVLEPGTFTVMVGGSSLDKDLQKVKFNVK

Enzyme Prediction     

No EC number prediction in MGYG000001345_01954.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	122	351	5.5e-72	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.01e-178	1	769	1	763	beta-glucosidase BglX.
COG1472	BglX	5.46e-101	47	476	1	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.86e-82	1	755	3	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.01e-76	48	384	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.58e-67	422	652	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH55225.1	0.0	1	771	1	771
QNL37131.1	0.0	1	771	1	771
QIU95347.1	0.0	1	771	1	771
QNL39934.1	0.0	29	771	28	770
QIU93423.1	0.0	29	771	28	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	9.84e-150	34	771	8	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	5.46e-149	34	771	8	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	2.65e-146	29	770	36	784	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	9.49e-144	76	758	36	740	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	3.22e-139	98	755	41	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.20e-167	115	771	51	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	9.06e-129	94	758	68	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	1.08e-127	4	771	3	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	1.06e-126	94	758	68	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
A7LXU3	7.45e-115	31	760	32	767	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000198	0.999204	0.000154	0.000138	0.000132	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_01954.