CAZyme Information: MGYG000001345_02454

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_02454
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606	MGYG000001345_34|CGC16	68138.58	6.3022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 962879; End: 964699 Strand: +

Full Sequence      

MFTDYKSFLLSSYYCIFELTTSQNQIKMKKKQVLLAVFAATMLTPTVAWAQYPQISGEAK
ENYTKMMTEERKRSDEAWAKALPIVQKEAREGRPYIPWAGRPYDLPQADIPSFPGAEGGG
MYSFGGRGGKVITVTNLNDRGPGSFREACETGGARIIVFNVAGIIRLESPIIVRAPYVTI
AGQTAPGDGVCIAGESFWVDTHDVVVRHMRFRRGETKVWHRDDSFGGNPVGNIMIDHCSC
TWGLDENISFYRHMYDPSEGQYESKDLKLPTVNVTIQNTISAKALDTYNHAFGSTLGGEN
CAFARNLWASNSGRNPSIGWNGIFNFVNNVVFNWVHRSSDGGDYTAMFNMINNYYKPGPA
TPKDSNVGHRILKPEAGRSKLDHKEYGRVYADGNIMEGYPEITKDNWNGGIQIETQPNTD
GYTEYMRSYQPFEMPYINIMGAKDAYDYVLKHVGANIPCRDIVDERVIEEVRTGIPYYEK
KLPKDAYGDLTGLSPKSMGEDGQFKYRRLPKDSYKQGIITDVRQMGGYPEYKGTPYVDTD
KDGMPDEWEIANGLNPNDPSDANKDCTGDGYTNIEKYINGISTKHKVDWRDMKNNYDTLA
EKGKLM

Enzyme Prediction     

No EC number prediction in MGYG000001345_02454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	162	355	3.4e-64	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18884	TSP3_bac	0.002	538	559	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT29068.1	0.0	28	606	1	579
QUR43136.1	0.0	28	606	1	579
CBK65860.1	0.0	28	606	1	579
QRN01963.1	0.0	28	606	1	579
QUT81784.1	0.0	28	606	1	579

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XMA2	3.31e-48	112	585	23	420	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	4.58e-48	112	585	23	420	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B8NQQ7	8.58e-48	112	581	22	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	4.19e-46	112	581	22	413	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
A1DPF0	5.92e-46	112	585	23	420	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.229454	0.749083	0.020063	0.000750	0.000374	0.000272

TMHMM  Annotations     

start	end
33	55