CAZyme Information: MGYG000001345_03183

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_03183
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887	MGYG000001345_35|CGC8	100093.79	5.8964

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 705748; End: 708411 Strand: +

Full Sequence      

MYKVYRKIILACLLLIVAGTVCGQRVTQTINDGWKFSLFEGDAFDADFDVSGWTDVSIPH
TWNAKDAEDEIPGYFRGKGWYRKAVIVEELIAGQRVYLCFEGANQETNVFVNGKLVGNHK
GGYSAFTFDVTDYVHTGCNLVAVSVDNSYNPDIAPLSADFTFFGGLYRDVYLVYTSPVQL
STTHYASSGVYLKIVGITDAQAEVCAKTFLSNALKSNQALILETEILDADGNRVALSAKK
VNVKAGEKNVAFEALMTIAQPKRWDVDSPYLYKVYSRLKNKKGEVLDCVVNPLGIREYHF
DAEKGFFLNGKYRKLIGTSRHQDYKGMGNALRDEMHIRDIQLSKDMGSNFLRVAHYPQDP
VVMQMCDKLGLLTSVEIPIVNAITQSRAFMDNCVEQATEMVCQNYNYPSVIIWAYMNEVL
LRPPFNPDNKKERAEYMKFLHQIASAVEAQIRSLDSERYTMLPCHSASQIYQEAGITELP
MLLGFNLYNGWYGGNLGGFEEKLEELHKEFPHKPLLITEYGADVDTRIHSFSPVRFDFSC
EFGSVYHEHYLPEILKRDYIVGAMVWNLNDFYSEARRNAMPHVNNKGLVSTDRERKDGYF
LYQAYLKESPVLHIASKSWKNRAGASRDGKSCTQPLKVYTNADKVEVFLNGKSLGVYPVA
DKVVSVDIPFVNGKNVVDAVIEKEGREYRDQYVCDFKCVNVKNGFTEINVLLGARRYFED
RIAEMCWIPEQAYAEGSWGYIGGEVAPNKTRYGSLPASDTDILGTDQDPVFQTQRVGIEA
FKADVPDGVYAVYLYWTELTSENKREALVYNLGNDVVREDYINRVFSVDINGVSVAKQLN
IAEEYGSERAVIKKYIVPVSQGKGLVVRFGAVESVPILNAIRIVKEY

Enzyme Prediction     

No EC number prediction in MGYG000001345_03183.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	25	584	6.4e-101	0.5824468085106383
CBM57	723	881	3.7e-25	0.8979591836734694

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	7.09e-62	25	571	10	561	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.18e-54	34	596	19	582	beta-D-glucuronidase; Provisional
PRK10340	ebgA	6.12e-38	28	418	42	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	1.92e-24	306	605	8	296	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK09525	lacZ	1.24e-22	28	418	53	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR46284.1	0.0	1	887	1	887
QUT25417.1	0.0	1	887	1	887
QDH52806.1	0.0	1	887	1	887
CBK66217.1	0.0	1	887	5	891
QRN00279.1	0.0	1	887	1	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6D50_A	1.94e-200	15	887	23	886	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
5UJ6_A	4.28e-200	24	887	24	878	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D8G_A	4.80e-198	15	887	23	886	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
6ED1_A	3.94e-167	29	885	28	877	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
3FN9_A	2.78e-110	25	691	5	660	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	6.58e-113	5	704	26	726	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
A7LXS9	2.33e-65	18	656	35	697	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P77989	1.65e-52	26	420	15	390	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	3.18e-50	10	655	28	665	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KN75	3.55e-48	24	655	25	642	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006903	0.821791	0.170357	0.000352	0.000283	0.000287

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_03183.