CAZyme Information: MGYG000001345_03185

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_03185
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000001345_35|CGC8	40046.84	6.106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 708770; End: 709828 Strand: +

Full Sequence      

MLDKFGTEEKWIEGTARMIHSLGFSGAGSWSNEEAIASYNASHKEVLTRSIILNLMSGYG
KKRGGTYQLPGNTGYPNQCIFVFDPEFETYCDEMAQKLVANKTDKNIIGYFSDNELPFGP
KNLEGYLTLKNPNDPGRLYAESWLKQQGITLQQITDEHREEFAGVVAERYYKVVSEAIRK
YDPNHLYLGSRLHGKPKFVRQIVEAAGRYCDVVAINYYGAWTPSEKTMKHWGEWAQKPFI
ITEFYTKGMDSGLANTTGAGFTVQTQQERGYAYQHFVLGLLESGNCVGWHWFRYQDNDPT
AKGVDPSNLDSNKGLVDNEYNLYKPLADAMKELNINAYRLADWFDQQSTNNK

Enzyme Prediction     

No EC number prediction in MGYG000001345_03185.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	2	338	4.8e-86	0.5467075038284839

CDD Domains     

MGYG000001345_03185 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH57474.1	1.90e-271	1	352	119	470
QUT25416.1	1.90e-271	1	352	119	470
QUT80053.1	3.83e-271	1	352	119	470
QDM12614.1	3.83e-271	1	352	119	470
QRN02213.1	1.56e-270	1	352	119	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T3B_A	5.89e-76	5	346	142	481	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]
4BQ2_A	3.08e-28	9	338	397	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	7.60e-28	9	338	397	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	2.73e-23	9	338	415	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	1.57e-18	126	338	550	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	3.45e-20	83	340	663	951	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	2.51e-15	1	338	547	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_03185.