CAZyme Information: MGYG000001345_03186

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_03186
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	MGYG000001345_35|CGC8	57916.62	5.3606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 709839; End: 711392 Strand: +

Full Sequence      

MKKLFILGTFLFISSIPMVSCTDDDDKDPNFMPPDIVMGGGDVESEYPEDLPAPGASVMY
TPSLNANMYRPISVKYSSAYPPISSWKTENTRIIAYMDGYKPAIKTLKAYQESVNKYGSS
TTLPKQAATGRFYTKKIDGRWWLVDPEGCLHLERSATSLRKGTSSRNKTAWNSRFGTDEK
WLSTTQRELSEIGFHGTGAFCTGTYSLIQTHNASNPSSPLTLAPSFAFLSQFKSAKSYNY
PGGSDDNAAGLVFYNGWTEWCESYLAGSAFADYLRDPNVLGFFSDNEINFSSNSSRILDR
FLAISNSSDPAYVAAKAFMDSKGTQSVTDDLNNEFAGIVAEKYYKAVKEAVKKVDDKLLY
LGTRLHGTPKYMEGVVRAAGKYCDVISINYYSRWSPELTTAIADWANWADKPFLVSEFYT
KGVEDSDLNNQSGAGYSVPTQNERAYAYQHFTLGLLEAKNCVGWHWFKYQDDDGTDNSSK
PANKGLYDNSYQLFPYLSFFARELNFNAYDLIQYFDK

Enzyme Prediction     

No EC number prediction in MGYG000001345_03186.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	165	509	3.6e-51	0.557427258805513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02836	Glyco_hydro_2_C	0.003	340	418	138	210	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRN00280.1	0.0	1	517	1	517
QUT30898.1	0.0	1	517	1	517
CBK66219.1	0.0	1	517	1	517
QUR46285.1	0.0	1	517	1	517
QUT80054.1	0.0	1	517	1	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T3B_A	3.37e-143	51	517	24	481	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]
4BQ2_A	1.05e-12	113	509	243	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	2.42e-12	113	509	243	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	1.93e-09	340	486	595	734	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	1.93e-09	98	510	247	760	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	2.18e-09	117	475	476	913	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000340	0.121415	0.878020	0.000075	0.000085	0.000067

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_03186.