CAZyme Information: MGYG000001345_03770

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_03770
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	MGYG000001345_36|CGC5	94358.62	6.5981

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 292795; End: 295263 Strand: +

Full Sequence      

MKKVFLFLYFSIISLLISAADTFVIFTPADHHFPLIKNGKPCSILMDINEDKGVKMAIDN
LQQDLLNVCGSQSEINTKASDKQCLLIGTLQTPLIQKLIASGKIDRKELEGKNEKYILQV
VTAPLEGVDEALVITGSDKRGTIYGIYELSKQIGVSPWYWWADVPVKKQTDIYIKPGTYT
DGEPKVEYRGIFLNDEWPCLGSWSQEKFGGFNSQFYKHVFELVLRLKGNFMWPAMWASAF
YDDDPQNGELANTMGIVMGTSHHEPMALAQQDWKRRGKGEWDYNHNAKELRNFWTSGMER
VKNWETVVTVGMRGDGDEPMSEGANISLLENIVKDQRKIIETVTKKKAKNTPQVWALYKE
VQDYYDKGMRVPDDITLLLCDDNWGNVRKLPNLNEKPRSGGYGMYYHFDYVGAPRNSKWI
NISPIPRVWEQMNLTYEYGVRKLWIVNVGDLKPMEYPITFFLDMAWNPEKFNAQNLQRHT
EDFCAQQFGEKYAKEAARILSQYAKYNRRVTPELLNAQTYSFHYNEWERVVNEYNLLALD
AHNLGFLMPASYKDAYDQLILFPVQACANLYNMYYAQAQNQRLAAEQKTEANRWADKVVA
CYERDSLLTHYYHKVMSKGKWNHLMDQVHIGYTSWNNPPKQIMPKITRVPEQAGTYTFIE
TNGYISIEAEHFTRAIAEGETTWNLIPDFGKTLSGVTTLPVTKTPDKMCLEYDIEIEKAG
SVEVTLLLAPTLNFNDNKGLRYAICLDGDKEQIINFNGHYQGELGKWQANPIIESRSNHL
LAKEGKHTLRIRPLDPGIVFEKIQINTGGLQPSYLGAPETLK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	31	803	3.3e-288	0.9971305595408895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	182	514	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.25e-60	657	819	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	3.07e-04	77	149	55	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93956.1	0.0	1	822	1	822
EDV05080.1	0.0	1	821	17	845
QDO71564.1	0.0	17	821	6	814
QUT92919.1	0.0	17	820	21	828
ALJ61511.1	0.0	17	820	21	828

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	1	815	12	844	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.81e-283	33	820	17	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.85e-280	33	820	16	833	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	3.49e-215	43	816	24	929	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	8.37e-147	53	820	31	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000393	0.998959	0.000152	0.000162	0.000151	0.000153

TMHMM  Annotations     

start	end
5	27