CAZyme Information: MGYG000001345_03781

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_03781
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	MGYG000001345_36|CGC5	61249.52	4.9117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 316601; End: 318247 Strand: -

Full Sequence      

MKNITLLFCLFLANILLGACSGGEDEKKEMDEGKGAYALFLKKSITVSTGESQTDVVVEW
AKTSWEITIGEGEIVKSVTPTSGGNSSGEKQYTKVRVSCGANSTMKKRTQTIHLFDKTNE
TTVDLLVEQEPPFKSVTLTVDPMVKYQPVVGFGGMYNPKIWCGDNLISAPQLDKMYGAGG
LGYSILRLMIYPNESDWSADVEAAKAAQANGAIIFACPWDCTDALADKITVNGKEMKHLK
KENYEAYANHLIRYVTFMKEKGVNLYAISVQNEPDMEFTYWTPSEVVDFVKQYGARIRET
GVKLMSPEACGMQPEYTDPIINNAEAFAQTDILAGHLYQGFTDLSSGYVKNRHDYICGVY
SRIQGKTWWMTEHLFNDGENSDDSSKWEFLKWQYSLNHLGKEIHMCMEGYCSAYIYWYLK
RFYGLMGDTDKRSPTSEGEITKNGYIMAHYAQYATETTRIKAVTNNEEVCATAYWDEKTG
EVTIVLLNLNGASQWLEIPLAGIKKASAVETNETKNMEVIDTGLMESAEGITVLLSANSI
TSVRLTFK

Enzyme Prediction     

No EC number prediction in MGYG000001345_03781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	137	501	1e-117	0.9824561403508771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	6.95e-65	135	488	33	370	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
cd14948	BACON	0.002	42	130	6	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam06964	Alpha-L-AF_C	0.006	440	510	61	149	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT78601.1	0.0	1	547	1	547
EDO10799.1	0.0	1	547	1	547
QRQ55177.1	0.0	1	547	1	547
ALJ48333.1	0.0	1	547	1	547
QUT26886.1	0.0	1	547	1	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GTN_A	4.77e-58	138	542	5	386	CrystalStructure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3GTN_B Crystal Structure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3KL0_A Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_B Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_C Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_D Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL3_A Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_B Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_C Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_D Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL5_A Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_B Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_C Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_D Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis]
4UQA_A	1.67e-55	139	542	25	407	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
4CKQ_A	8.79e-55	139	542	25	407	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQ9_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQB_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQC_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQD_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQE_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
4QAW_A	1.61e-54	147	542	13	385	Structureof modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_B Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_C Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_D Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_E Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_F Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_G Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_H Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis]
5A6L_A	6.43e-54	139	542	25	407	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5A6M_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q45070	4.39e-57	138	542	36	417	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
Q6YK37	3.52e-53	147	518	46	395	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_03781.