CAZyme Information: MGYG000001345_03808

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_03808
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
734	MGYG000001345_36|CGC6	82017.69	7.1465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 367237; End: 369441 Strand: +

Full Sequence      

MKRLTPYSWLILIIFSSCLTGNKVASTDKQIESLLSQMTLEEKIGMLHSNTMFSSTGVPR
LGIPDLHYSDGPHGVRFEGVANGWESARWDNDACSYLPALSALASTWNRDLAQLYGEVLG
AECKARGKHVSLAPGVNIHRSLLNGRNWEYFSEDPFFSGELAVPYIQGVQSQGVASCVKH
FALNSQAYNQYKVSVEVDERTLHEIYLPAFEAAIQRGGAMAAMAAYNKVRGLWCTESPYL
LDTLLRDELGFDGLVVSDWNAVHNTERTALCGMDVEMGTSIKENGKYAFNKYYLADPLLK
KVRNGEIPEEAVNKKVRNILKLMIRLDLIGQAPYDTTGMAAKLAMPIHTKAARKIAEESL
VLLKNSKDMLPLDPAQYKNVAVIGANATEVFAAGGGSTKLKAKYEVTPLEGLQNLLDGKA
RIEYAPGYQLNKKAYKVGHWFTNEFDKSDEELYKKAINTAAQAELVIYIGGTSHEHGSDC
EGYDKPNLKLPYQQDRLLKGILEVNPNTVVVLISGGPVEIGEWYNDATALLYCSFLGMEG
GNALARTLFGEVNPSGKLTTTWCKCLEDMPDHVFGEYPGINDTVRFKEGLMVGYRYFDTY
RVVPQFEFGYGLSYTTFTYSDIKMKPVWKESDTEFAVSFTITNTGKRYGQEIAQLYLHQN
KCSVERPFKELKGFTKVGLKPGESKQVTIKLPRRALQYYDTESKHWKDEPGMFTVLIGAS
SRDIKLQKNFELKK

Enzyme Prediction     

No EC number prediction in MGYG000001345_03808.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	57	277	7.7e-66	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.49e-106	1	732	1	764	beta-glucosidase BglX.
COG1472	BglX	7.88e-67	59	410	56	384	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	5.42e-63	22	704	44	756	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	5.80e-60	360	594	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	3.25e-38	60	322	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM99038.1	0.0	1	734	1	734
CBK67923.1	0.0	1	734	1	734
QGT73041.1	0.0	1	734	1	734
QUT32386.1	0.0	1	734	1	734
SCV07713.1	0.0	1	734	1	734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.23e-158	31	729	5	665	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.23e-125	35	724	9	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.99e-124	29	732	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.22e-122	29	732	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	3.65e-110	3	725	15	821	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	3.43e-195	8	731	8	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	6.73e-158	31	729	5	665	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
P27034	3.12e-138	31	732	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
F6C6C1	3.81e-124	38	724	12	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	8.12e-123	38	724	12	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000578	0.176961	0.822137	0.000100	0.000118	0.000106

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_03808.