CAZyme Information: MGYG000001345_04259

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_04259
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	MGYG000001345_36|CGC19	61041.8	4.8223

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 968058; End: 969710 Strand: -

Full Sequence      

MRNKFFLCLFVLVSLTACKDTKWVEVPGGMPPEGAITGQPGVDDPAEKTLINCQYIGGDP
FELNRIPVENLIVSNDLIYLAARPYANGDIAFDLPINDATFTGGVSHEATYEGRSGVIKF
DGTGKMNGKDGLLHSTEETFNKSFTFATYIFIDEWVPGAYIFKKTSGDKVLAALQLGANE
QTVSWALGNASVTAGTYVDAKGLAPGAWHYLAVDYDGNKKQFRIFVDAWSSTLDKEIVLP
TARADFYIGENFKGRLDETSFWSMAAGTGGKNGIKFDNWNMVAKVLAYWQYDDSTNPGKD
SHTWLDRWKKIRETLAAQVGNDSRKLRLGFGSGQWRQMMSADNTRTAFANNLKSVLKEYE
FDGVDLDIEWPTTETEYANYSATIVKIRQILGKDVCFSVSLHPVAYKISKNAIEALDFMS
YQCYGPAVMRYSYEQFVKDAEMAVEYGIPADKLVLGVPFIGTTGVNGEQVSYSDFINGGL
SDVALDEFTYNGKTYTLNGQNTIRKKAKYACEEGYRGIMSWGSDVSVNNEKSLLKAIQEE
FVAYEINNPK

Enzyme Prediction     

No EC number prediction in MGYG000001345_04259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	319	530	5.7e-32	0.8074324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	2.02e-23	331	521	75	302	Glycosyl hydrolases family 18.
cd06545	GH18_3CO4_chitinase	8.47e-20	329	537	69	253	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
smart00636	Glyco_18	4.44e-18	332	524	79	332	Glyco_18 domain.
cd06548	GH18_chitinase	8.39e-15	344	524	109	320	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd00598	GH18_chitinase-like	2.11e-13	287	449	32	200	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR45352.1	0.0	1	550	1	550
QUT31768.1	0.0	1	550	1	550
QRM99478.1	0.0	1	550	1	550
QDH53607.1	0.0	1	550	1	550
CBK67377.1	0.0	1	550	1	550

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	9.12e-17	332	541	91	305	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
3AQU_A	1.89e-09	314	543	57	345	Crystalstructure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_B Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_C Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_D Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana]
3G6L_A	3.06e-09	268	478	19	296	Thecrystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea [Clonostachys rosea],3G6M_A crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with a potent inhibitor caffeine [Clonostachys rosea]
4URI_A	3.99e-08	287	521	29	317	Crystalstructure of chitinase-like agglutinin RobpsCRA from Robinia pseudoacacia [Robinia pseudoacacia],4URI_B Crystal structure of chitinase-like agglutinin RobpsCRA from Robinia pseudoacacia [Robinia pseudoacacia]
1D2K_A	6.55e-08	291	537	46	359	ChainA, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O81862	1.15e-08	314	543	80	368	Class V chitinase OS=Arabidopsis thaliana OX=3702 GN=ChiC PE=1 SV=1
A0A1B1J8Z2	1.18e-07	337	521	134	377	Class V chitinase CHIT5 OS=Lotus japonicus OX=34305 GN=CHIT5 PE=1 SV=2
P0CB51	3.93e-07	291	537	81	394	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
Q1E3R8	3.93e-07	291	537	81	394	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
E9ERT9	1.20e-06	300	534	91	392	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000216	0.171787	0.827781	0.000072	0.000082	0.000068

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_04259.