CAZyme Information: MGYG000001345_04356

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_04356
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		45226.92	5.0787

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 1135809; End: 1136993 Strand: +

Full Sequence      

MKKQINILLVGLASVFMSCSDVEEVSALYPEYEEVKELSIVDKNATSETKALYSNLWAIQ
SKGFMFGHHDDLWYGRKWYNEEGRSDTHDVCGDYPAVFSFDVAEIMDDRYQNPENEIRKR
VALEAYERGEVLIACAHLNNPLTGGDSWDNSSNEVVKEILKEGSPTHLKFKTWLDRLANF
ALNLKGKNGELVPVIFRPYHEHTQTWSWWGSSCTTSDEFTSFWKFTVNYLRDTKNVHNLI
YAISPQIDSVQGRENFLFRWPGNDYVDFLGMDSYHGLSPVVLTTNMNTLSRLSKELKKPC
GVTETGVEGIQRDGVPEKNYWTQQILTPVTGQFVSMIVMWRNKYDPSESESHFYSVFKGH
ASEKSFIKMYESPVSLFSADLPDMYTMAEGMNVK

Enzyme Prediction     

No EC number prediction in MGYG000001345_04356.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	41	349	1.9e-59	0.9273927392739274

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.25e-29	41	274	1	230	Glycosyl hydrolase family 26.
COG4124	ManB2	1.19e-11	175	309	169	299	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT31668.1	1.97e-302	1	394	1	394
QRM99613.1	8.04e-302	1	394	1	394
CBK67266.1	8.04e-302	1	394	1	394
QGT72560.1	2.31e-301	1	394	1	394
ALJ60278.1	7.39e-184	18	394	17	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	1.27e-79	46	387	9	345	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	1.07e-66	39	385	32	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	1.07e-66	39	385	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	1.96e-66	39	385	55	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	8.32e-66	39	385	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	5.60e-44	38	342	47	362	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.16e-32	38	274	40	278	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P16699	8.86e-14	34	346	28	334	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
O05512	5.49e-12	126	306	120	294	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
G2Q4H7	1.97e-11	26	306	162	424	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000189	0.178219	0.821336	0.000087	0.000092	0.000081

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_04356.