CAZyme Information: MGYG000001345_04511

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_04511
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		90936.34	6.3227

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 1351717; End: 1354167 Strand: +

Full Sequence      

MKKKIGGIGLCMLWSILTCAQTITPQAEQRAKDIVSKMTLQEKIEYISGYTSFSLRAIPR
LGIPEIKLADGPQGIRNHAPKSTLYPSGILSASTWNRELLYKLGQGLGQDAKARGVNILL
GPGVNIYRAPLCGRNFEYFGEDPYLTGETAKQYILGVQSEGVIATIKHFAANNQEWSRHH
ASSDIDERTLQEIYFPAFRKAVQEANVGAVMNSYNLLNGVHATEHKWLNIDVLRNLWGFK
GILMSDWTSVYSAVGAANAGLDLEMPKGRFMNLENLLPAIKAGTVTEETINLKVQHILQT
LIAYDMLDKEQKDSNIAEDNPFSRQTALELAREGVVLLKNEGNLLPLKGKTAVMGPNANL
IPTGGGSGFVTPFSTVSVAQGLKELKKKNLLLLTDDVIYEDIVHEFYTDANRQMKGFKAE
YFKNKTLSGQPEVIRTESSVDYDWGYGAPLDGFPTDGFSVRWTACYMPQTDGQLKLHIGG
DDGYRLFVNDKHITGDWGNHSYSSREVELPVEGGKEYRFRIEFFDNISSAIIRFNAYSLN
EAKLRQGLAKVDNVVFCTGFNSNTEGEGFDRPFALLRYQELFIKKIASMHPNVVVVLNAG
GGVDFTNWYDAAKAILMAWYPGQEGGQAIAEILTGKISPSGKLPISIEWKWDDNPVHGSY
YENLKAEIKRVDYSEGVFVGYRGYDRSGKEPFYPFGYGLSYTTFAYSNMAAEKTGEHQVT
VSFDIENTGKMDASEVAQVYVHDVQSSVPRPLKELKGYEKVFLKKGEKKRVAVVLDEDAF
SFYDMNQHRFVVEKGDFEILVGPVSSQLPLKATVEL

Enzyme Prediction     

No EC number prediction in MGYG000001345_04511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	57	266	1e-68	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.91e-83	60	816	101	764	beta-glucosidase BglX.
COG1472	BglX	9.73e-78	56	381	53	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.89e-53	29	812	51	779	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	5.24e-48	60	298	63	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.37e-39	335	681	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK67093.1	0.0	1	816	1	816
QRM99763.1	0.0	1	816	1	816
QUT31468.1	0.0	1	816	1	816
QUT26117.1	0.0	1	816	1	817
ALJ47550.1	0.0	1	816	1	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.15e-138	32	816	6	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	6.77e-127	32	808	7	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.13e-123	32	808	7	828	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
5WAB_A	4.68e-116	35	816	9	663	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.16e-115	29	813	2	710	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27034	4.83e-149	33	816	4	808	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
P14002	1.18e-137	32	816	6	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
Q5BFG8	4.60e-133	32	802	12	824	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
A1DNN8	3.10e-131	29	808	11	857	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
Q9P6J6	2.20e-129	28	810	3	817	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001034	0.416010	0.582368	0.000188	0.000187	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_04511.