CAZyme Information: MGYG000001346_00661

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_00661
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000001346_13|CGC1	54648.34	4.9306

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 54153; End: 55610 Strand: +

Full Sequence      

MNRMKNLFTLLTLLLWTLVACSNDSAADEKPGSGGTDIPAGNLPMQNVARAIELIDNAVE
CYFTGTGMAMSRYYNPYTGNRSSELGSVWMYTSSIEAVNAAMKAMKTGQAKGETALYDSH
FNRYKELLTQLYDNLEYYAGTFTLTSYTQTKQWTVYGVNRGNDKGAAQVEGILNVYDDQM
WLVRELLESYHITGEQRYLEKAEYLMEYVLDGWDCTLDEQGNPLGGITWGPGYLTKHSCS
NGPIVSPLVWLHEIYKGKSDEVTYGYVAADNSRKLRTEKKSDYYLGFAKAVYDWQKKYLL
RPDGVYDDMMGGYDSPDIKYVTIDGERYRTGSKLRDRVGPAITYNSGTMLSGAADLLRAT
GDAAYRTDLAELTDNSFAYFAKPDATKPGCYTFDISGFCNWFNGVLMRGYVDAYSAHTVA
ASCIEAFQNNLDYAYENYQYKHMLPTNLLVGWNKAERTKNNVEGMFTFAFAAEYAVLANY
EWSKK

Enzyme Prediction     

No EC number prediction in MGYG000001346_00661.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	67	453	3.1e-40	0.8435754189944135

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	4.23e-12	176	413	86	291	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	8.15e-06	176	364	92	229	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT62205.1	0.0	1	485	1	485
QQA30660.1	0.0	1	485	1	485
BBK85776.1	0.0	1	485	1	484
QPH58159.1	0.0	1	485	1	484
QUT64972.1	0.0	4	485	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C1S_A	7.18e-13	176	415	107	308	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	2.46e-12	174	408	131	318	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.84e-11	174	408	132	319	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	5.78e-11	181	408	140	319	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4BOK_A	5.99e-10	177	368	90	233	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000050	0.062224	0.937658	0.000024	0.000030	0.000024

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001346_00661.