CAZyme Information: MGYG000001346_00919

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_00919
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000001346_13|CGC6	76870.24	5.1777

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 400656; End: 402683 Strand: +

Full Sequence      

MTMKLKKTLQIILALCLGLWMISCQQEHIKLTSPNGKLSLEFTLDEEGAPRYCLRHAGKN
ILLPSRLGLVLKDAPDLLTGFVLKEVKHDSHNDVWQPVWGEEAEIVNHYNELRVCLKEET
SLERELNIIFRLFDDGMGFRYEFPRQQQLQEFLIDDEVTEFVFPADYDAWSIPVKGVRFY
EALFEKKTLSKMGWVSTPVTIETTDSLYLAIHEANLTDYAAMNLKPVEQLEDNKTVTLRA
ALTPWSTGEKVRVTDTRVSPWRTMIVAESAGDLLLSRLMLNLNEPCRITDTSWIQPMRYI
GIWWTYHMKHNTWHAGPHHGATTENTMRHIDFAAANNLGGVLVEGWNEDWATWKFSFTKP
YTDFDIQRITDYGRSKGVALIGHHETGGNVSNYENQMEDGFKFYEKYGVHQVKTGYVGNL
LDGKEYHSSQFGVLHYRKVIEAAARHRICIDNHEPVIPTGLQRTFPNLMTQEGVRGQEWD
AWDVDGGNPPSHTVILPFTRGLAGPMDFTPVTFRFVNDVMPQTRVHTTLAKQLALFVVLY
SPLQMASDEIENYEANPEPFNFIVSCPTDWSRTVVPEACIGSYVTIARCDKGEGCWYIGS
ITGDEERTANISLSFLDTDKSYLATIYRDAPESDYETCPAAILIEEREVTYSDTLTIRQA
RSGGTAVRLCPIKDC

Enzyme Prediction     

No EC number prediction in MGYG000001346_00919.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	21	669	1.1e-227	0.9873217115689382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	1.06e-145	290	567	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	4.12e-78	33	272	1	222	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	4.32e-36	570	669	1	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT64715.1	0.0	1	675	1	675
QBJ17615.1	0.0	1	674	1	674
QMI79109.1	0.0	1	674	1	674
QUR45766.1	1.32e-305	15	672	13	664
QUT92729.1	4.43e-297	28	669	27	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQ4_A	2.54e-181	33	668	5	657	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	2.54e-181	33	668	5	657	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	7.18e-181	33	668	5	657	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	1.27e-161	30	674	4	708	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	1.30e-161	30	674	13	717	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	7.95e-163	3	674	1	728	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	5.57e-61	26	669	20	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	5.02e-42	32	670	44	621	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000041	0.047288	0.952642	0.000016	0.000021	0.000017

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001346_00919.