CAZyme Information: MGYG000001346_01003

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_01003
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643	MGYG000001346_13|CGC10	74140.1	6.7003

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 530615; End: 532546 Strand: +

Full Sequence      

MKKRLTLTFWGMLVAFSVMAEAVKVTSPDGEYEFTVSDDGQLSYSLFYQQKEVIEPSRLG
IEWNENWYDGIRIVTSRNSRIDKNWKPVYGERAVVKELYNACEIELAKTGSRKRMVLDVR
AYNEGVAFRYRFVGGEYLKIENEFTQFTLPKGTLAWHTERAQTPYNLLPLEGWENESDRP
LMLQLPEGQYACLAEAQVVDYVRTKFKLSDEKPYTLLTSMYGIVEDIAPYHTPWRIVMCA
SRPGDILANNDLLLNLNPDCKIADTSWIKPGKVMREVTLTTEGGKALVDFAVKRRLQYIH
FDAGWYGFEYDKSSDATTVTLDPRRNEQIDALNLQEVISYAKSKGIGVILYVNQRALQQQ
LDEILPLYKSWGIAGIKFGFVQVGSQIWTRWMHEAVKKCAQYGLMVDIHDEYRPTGFSRT
YPNLMTQEGIRGNEEFPDATHNTILPFTRFVAGAADYTICYYRQDFGRLHTDKDSYGVPR
SRTIQTTPAHQLALSVIYYSPLQYMYWYDKPSDSQDEPELKFFDDVYTTWDDTQVLQGKI
GEFVTIARRKGEEWFVGAITNNDAREQEISLDFLPQGKSYIAEIYTDGDKSVKTRTRVRC
QRYLVNAQSVLRFSLRASGGAAIRLVLDTGDNRNVRNYRKQKL

Enzyme Prediction     

No EC number prediction in MGYG000001346_01003.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	14	625	1.3e-182	0.9904912836767037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	6.86e-69	264	526	1	277	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	7.28e-57	27	246	1	223	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	3.32e-41	530	626	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00191.1	0.0	1	643	1	643
QUT34107.1	0.0	1	643	1	643
QUT56878.1	0.0	3	643	2	644
QQY40417.1	0.0	3	643	2	644
ABR37863.1	0.0	3	643	2	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	5.72e-73	27	625	20	654	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	4.33e-72	27	625	6	640	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5HQ4_A	1.02e-67	25	624	3	657	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	1.97e-67	25	624	3	657	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	2.73e-67	25	624	3	657	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	1.86e-72	3	625	2	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	1.90e-67	1	625	1	723	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	1.04e-47	40	622	57	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000321	0.998837	0.000220	0.000212	0.000194	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001346_01003.