CAZyme Information: MGYG000001346_01688

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_01688
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305		35728.37	9.7968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 273912; End: 274829 Strand: +

Full Sequence      

MTAIKSQNRLFSIVIPTWNNLAFLKLCIQSIQRNSYYNHQIIVHVNDGSDGTLEWIKKAG
IDYTHSEQNIGVCFAMNMMRTKVKTDYILFLNDDMYVLPFWDKVLYDEIEKLSDNYFFLS
ATSIQPHTQSASTILANYGDSIETFQEDKLLKEYMNYKINDWMGATIPPNIVHRDIWDLV
GGYSIEYSPGMYSDPDFTAKLYMCGVRFMKGLQASRIYHFETKSTTRIRKNCGQMQFLLK
WGMTSSTFRKVFTYKGKDFKSQKIGTFKTGNRFKISLIRGRLKAIFYLLTKDFGPLWKFW
KKTFV

Enzyme Prediction     

No EC number prediction in MGYG000001346_01688.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	12	136	1.5e-17	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	8.39e-18	13	111	1	101	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.34e-17	13	111	1	104	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	2.13e-16	12	111	1	105	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	3.99e-16	12	202	1	177	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	3.59e-13	10	240	4	240	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT61399.1	4.86e-233	1	305	1	305
QUU01343.1	4.86e-233	1	305	1	305
QUT37226.1	4.86e-233	1	305	1	305
QMI80020.1	4.86e-233	1	305	1	305
QUT65907.1	4.86e-233	1	305	1	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.66e-07	7	170	3	158	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001346_01688.