CAZyme Information: MGYG000001346_01813

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_01813
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725	MGYG000001346_14|CGC8	80613.71	7.3756

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 455507; End: 457684 Strand: +

Full Sequence      

MRNKLLFLALPLLFGLQASAQHTQAFQDTTLSDEQRVEHLLSILTLDEKINLLSTDLGVP
RFNIPRCGHYEGLHGLTLGGPAMWGGRQRTEDGKVVPTDCPTTIFPQSYGLGSTWDTDLV
QKVAEQAAEEARYYMQTTGNKRHALVMRAPNADLARDPRWGRTEESFGEDAFLTAQLTIA
SVRGLQGNHPRYWKTASLMKHFLANSNEDGRDSTSSDFDTRLFHEYYAYPFYKGITEGGS
RAFMAAYNSWNGIPMSIHPCLEEITRKQWGNNGIICTDGGALKLLIEAHKSFPSFAEGAA
AVVKATTGQFLDAYVPYVKEALEKGLLTEVDIDKAIRGNIFVALKLGLLDGDNSRNPYLS
IGKNSTETPPFMTAEARRLAREVTAKSVVLLKNKKLLPLDAGKLRKIAVIGPYSDKIVQD
WYSGTPPYETTILSGIRNAVKEGTEIIHAEDNRMGQAEKAAAAADVAIVCVGNHPYGTRA
DWKFSPVPSDGREAVDRKSLMLPDEDLVKLVLKANPNTILVLVSSFPYTINWSQEHVPAI
VHITHCSQEQGNGLADVLFGKVNPAGRTVQTWVKDITDLPDIMDYDIRNGRTYMYHQGPV
LYPFGYGLSYSDFTYEKIESVKQDKKNIRVTVSVKNTSGRDGEEVVQLYASYPDSKVERP
SKQLRAFRRIPIKAGETRKVTLTVPKEELGYWNEGKQMFVVEPGTVKLLIGASSEDIRLE
GKIRL

Enzyme Prediction     

No EC number prediction in MGYG000001346_01813.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	59	305	4.9e-51	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.56e-103	18	718	18	758	beta-glucosidase BglX.
PLN03080	PLN03080	4.82e-83	26	711	42	769	Probable beta-xylosidase; Provisional
COG1472	BglX	7.73e-48	85	445	71	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.28e-43	403	610	16	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.48e-39	78	337	64	311	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT61512.1	0.0	1	725	1	725
QQA30002.1	0.0	1	725	1	725
BBK86491.1	0.0	1	725	1	725
QUT65783.1	0.0	1	725	1	725
AGU13698.1	0.0	1	725	1	725

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6R5I_A	1.06e-73	103	714	86	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	5.36e-73	103	714	86	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	5.46e-73	103	714	87	723	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	9.40e-73	103	714	118	754	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
7MS2_A	9.71e-70	37	725	5	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q94KD8	1.26e-81	3	684	4	723	Probable beta-D-xylosidase 2 OS=Arabidopsis thaliana OX=3702 GN=BXL2 PE=2 SV=1
T2KMH0	2.67e-79	27	715	24	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	2.86e-74	103	718	118	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.96e-74	103	718	118	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	5.32e-69	37	725	5	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000211	0.999234	0.000147	0.000157	0.000136	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001346_01813.