CAZyme Information: MGYG000001346_01816

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_01816
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000001346_14|CGC8	43311.47	4.4352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 462732; End: 463865 Strand: -

Full Sequence      

MKKILFCLPLLLLALQSCEIEDEYMYDKGLYTIDWDAAADSSSVTLIDRFWNTEENYFNY
GNDGSIKDFHYWPQAHAMDVMIDAYNRTGDSKYSDLFDKWYVGIKAKNGGSYWNNFYDDM
EWIALTMIRLYEVTDENKYLETSQEMWNEIKTGWNDYAGGGIAWTHDQLWSKNACSNGPA
ALIAARLYRINGNQEDLDWAVNIYKWERENLFNPATGAIYDNVNGETGELSTLSLSYNQG
TFLGAAYELYKITGEESYLKDARKAANFAISNSSMIDTGNNLLRDEGDGDGGLFKGIFMR
YYVQLIMEPNLDPIYKKKFITFFNNNAEILWRKGINKLDLLYNTNWAMNNSGNNHLTTQT
SGCTLIEAKALFEKSLK

Enzyme Prediction     

No EC number prediction in MGYG000001346_01816.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	50	352	5.9e-90	0.8575418994413407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	6.23e-63	35	332	2	315	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	4.86e-50	35	346	3	323	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.46e-10	47	220	2	174	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd04434	LanC_like	6.73e-04	80	270	60	252	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
cd04434	LanC_like	0.001	84	272	14	193	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA30005.1	2.85e-291	1	377	1	377
BBK86488.1	2.85e-291	1	377	1	377
QUT65780.1	2.85e-291	1	377	1	377
QMI79910.1	2.85e-291	1	377	1	377
QBJ18505.1	2.85e-291	1	377	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	3.63e-87	34	373	53	390	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.19e-85	34	373	54	391	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	9.43e-85	34	373	54	391	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	5.28e-55	35	373	3	341	ChainA, Lin0763 protein [Listeria innocua]
4D4A_A	6.24e-38	23	347	15	339	ChainA, Alpha-1,6-mannanase [Niallia circulans],4D4A_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4B_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4B_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4C_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4C_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4D_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4D_B Chain B, Alpha-1,6-mannanase [Niallia circulans],5N0F_A Chain A, Alpha-1,6-mannanase [Niallia circulans],5N0F_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBX_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBX_B Chain B, Alpha-1,6-mannanase [Niallia circulans],7NL5_A Chain A, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6FLP9	3.71e-13	64	327	54	337	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
P36091	2.87e-11	135	327	140	340	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
Q75DG6	6.84e-11	59	328	51	343	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.001161	0.998875	0.000000	0.000001	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001346_01816.