CAZyme Information: MGYG000001346_02173

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_02173
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000001346_14|CGC11	29103.7	7.7101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 908593; End: 909363 Strand: +

Full Sequence      

MKRIIGILCGLFFFLFSFAQETFQKETYISSRGDTLLYRLLRPEVMKPDEKYPLVLFLHG
AGERGNDNEKQLVHGGQMWLNPVNREKYPAFILAPQCPETGYWAYTERPSSFAPADMPLE
VPVSPIFRTLKELLDFYLAMPQIDKDRIYVMGLSMGGMGTFDMAVRYPEIFAAAIPICGT
VNPARLKAGKSVKFRIFHGDADNVVTPEGSRAAYRALKAIGADVEYIEFPGCNHGSWNPA
FNYPDFMEWLFNQKKK

Enzyme Prediction     

No EC number prediction in MGYG000001346_02173.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	36	236	7.2e-27	0.8810572687224669

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	2.05e-53	17	254	159	386	Predicted peptidase [General function prediction only].
COG1506	DAP2	1.80e-18	27	235	369	595	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0400	YpfH	1.06e-12	47	231	13	186	Predicted esterase [General function prediction only].
COG3509	LpqC	7.99e-11	31	209	42	208	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
COG0412	DLH	2.45e-10	134	243	100	210	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS60377.1	3.19e-53	36	256	22	246
BCI61582.1	8.06e-49	20	254	808	1042
QJW99051.1	2.92e-39	21	255	32	240
VTR91196.1	8.05e-36	21	255	31	239
QDU56037.1	5.10e-34	20	255	788	1007

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	4.94e-54	33	255	155	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	1.24e-26	32	256	17	218	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	2.07e-12	50	255	78	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
7JIZ_A	7.71e-08	134	239	112	218	ChainA, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7],7JIZ_B Chain B, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7]
4Q1V_A	2.20e-06	18	175	454	602	Crystalstructure of a putative dipeptidyl aminopeptidase IV (BACOVA_01349) from Bacteroides ovatus ATCC 8483 at 2.48 A resolution [Bacteroides ovatus ATCC 8483],4Q1V_B Crystal structure of a putative dipeptidyl aminopeptidase IV (BACOVA_01349) from Bacteroides ovatus ATCC 8483 at 2.48 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000724	0.998306	0.000407	0.000176	0.000178	0.000179

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001346_02173.