CAZyme Information: MGYG000001347_00810

Basic Information

• Species: Fusobacterium vincentii
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium vincentii
• CAZyme ID: MGYG000001347_00810
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000001347_1|CGC4	41636.82	9.1785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001347	2268272	Isolate	not provided	not provided

• Gene Location: Start: 850497; End: 851567 Strand: +

Full Sequence      

MKFFVSTGEASGDLHLSYLVKSVKARYKDVDFVGVAGEKSQREGVEILQDINELAIMGFT
EVLKKYKFLKRKAYEYLQYIKDNQIKNVILVDYGGFNVKFLELLKNEIKDIKVFYYIPPK
VWIWGEKRVEKLRLADYIMVIFPWEVDFYKKHNINAIYFGNPFTDFYKKVERTENKILLL
PGSRRQEIKAMLPVFEEIINDLKDNEFILKLNSNQDLKYTENFKKYNNLEIVIDKKLKDI
VSDCKLSVATSGTITLELALLGLPSIVVYKTTFINYLIGKYILKIGYISLPNLVLNDEIF
PELIQKDCEAKNIEKYMKKILENLPEIEEKIENMRKKVEGKAVVQSYADFLVKEGK

Enzyme Prediction     

No EC number prediction in MGYG000001347_00810.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	336	4.9e-102	0.9745762711864406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	4.05e-141	1	356	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	8.77e-93	1	345	2	366	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.01e-70	4	324	2	342	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.87e-64	5	335	10	359	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.69e-55	1	322	2	327	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEU32054.1	2.13e-255	1	356	1	356
QYR57136.1	2.49e-254	1	356	1	356
EFG34851.1	2.78e-251	1	356	1	356
ALF18230.1	1.13e-250	1	356	1	356
ATV05411.1	1.13e-250	1	356	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.64e-32	8	323	14	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.08e-31	8	323	14	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3JAC1	2.63e-51	5	313	10	334	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q39T49	4.83e-51	2	313	8	335	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	4.83e-51	2	313	8	335	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
C0QR27	8.43e-51	2	354	3	375	Lipid-A-disaccharide synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) OX=123214 GN=lpxB PE=3 SV=1
B2V704	8.95e-48	2	313	3	338	Lipid-A-disaccharide synthase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) OX=436114 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001347_00810.