CAZyme Information: MGYG000001348_00600

Basic Information

• Species: Helicobacter_D canadensis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D canadensis
• CAZyme ID: MGYG000001348_00600
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		43771.29	9.7599

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001348	1622997	Isolate	not provided	not provided

• Gene Location: Start: 597894; End: 599021 Strand: +

Full Sequence      

MKKIKIFVSALEYSANIHLFYLLNALQKKQLEFEICGIFDSEILKRDSSFSPNEFRVMGF
VEVLRLIPKFFKIKKALIALAKECDFALFMDSSSFNIPLLKSLHQAKNKPYLAYYILPQV
WAWKPYRAKIFSVYCDALWGILPFEGFYYPKTSNFSYVGHPLLDEIPFSYTKANSTNFIA
FMPGSRISEIKALFPVFKELVKHFKTMNKKALLIIPRHFKNRDLSKIYGDLRDFEISFET
YEGLKQCEFAFVCSGTATLESTLLGIPTILVYKARWLDYWIAKRLVKLNYIGLANIFLEF
LAYGSPKNNHNPQNFPIHAEFLQDQVKVETLLKAFYKFDNEKFFAQKEKLIQYLKNGSAE
NCARKIENFVKNLQN

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	6	345	4.1e-86	0.9463276836158192

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	2.20e-153	5	368	3	346	lipid-A-disaccharide synthase.
COG0763	LpxB	1.13e-88	4	366	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.45e-75	6	359	1	370	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.75e-74	6	368	8	381	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK00025	lpxB	1.90e-59	5	372	3	377	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ06254.1	8.23e-187	2	373	3	374
AWI33989.1	1.53e-170	1	373	3	375
QOQ98371.1	5.57e-160	1	374	1	391
BAK74603.1	1.56e-98	5	368	2	347
QKF78846.1	2.21e-98	5	368	2	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.24e-17	85	296	92	317	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.27e-17	85	296	92	317	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZKY2	4.06e-92	6	373	4	359	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=lpxB PE=3 SV=1
Q17WJ2	8.13e-92	6	373	4	359	Lipid-A-disaccharide synthase OS=Helicobacter acinonychis (strain Sheeba) OX=382638 GN=lpxB PE=3 SV=1
B6JM91	1.84e-90	6	373	4	359	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain P12) OX=570508 GN=lpxB PE=3 SV=1
B5Z7M7	2.60e-90	6	373	4	359	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain G27) OX=563041 GN=lpxB PE=3 SV=1
B2USW3	2.60e-90	6	363	4	350	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain Shi470) OX=512562 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001348_00600.