CAZyme Information: MGYG000001348_00812

Basic Information

• Species: Helicobacter_D canadensis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D canadensis
• CAZyme ID: MGYG000001348_00812
• CAZy Family: AA4
• CAZyme Description: 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556	MGYG000001348_1|CGC5	63922.3	7.1085

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001348	1622997	Isolate	not provided	not provided

• Gene Location: Start: 802159; End: 803829 Strand: +

Full Sequence      

MILPRDVTQSDFTAAVAKFEKALGKEWVFSSQEDLELYRDAYSPQWGDDDEPIASLALAP
KNVEEVQAIVKIANEFKIPLFPISTGKNLGYGSCAPQQRGQVVVDLKRMNKIIEVDDKRN
FCIVEPGVSYFDLYEYVEKNNLNVFLDIPDPGWGSPLGNALDHGWGYSYGMYRDHFGSHC
GMEVVLANGEILRTGMGALPKAKTFAENKYGYGPYVDGLFSQSNFGIVTKMGFWMMPKPE
HYMLISIKMKKREDLIPAVEILNYLEDSFIVGWPQYFSPLNPPYGKPMNEELKGYLTSKN
GLPDMNKIQNYALKNKIPYWNIDVSIYGCKEVCYANLEYIKRRFKVIDGVDISIVQEFDL
PLKLEQKKQLKHKVALGIPNMEIFWISTRGEAREPSDGHVWFSPIIPRDGRELLKCQEVY
MELFREFGVESPITPFSHPRSWMYRAFCFMLAFNNSRTDQAYNFKVRQMYRAMVKTAAEN
GWGDYRAAPTFQDDVMGAYSYNNHILRRFNEQLKDCVDPNGILAPGRGGIWPKNLREERF
ANNKRDALMKKEGREK

Enzyme Prediction     

No EC number prediction in MGYG000001348_00812.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	2	539	5.5e-147	0.9904214559386973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01565	FAD_binding_4	1.27e-30	54	195	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
COG0277	GlcD	2.47e-29	19	527	2	454	FAD/FMN-containing dehydrogenase [Energy production and conversion].
PLN02805	PLN02805	1.60e-14	53	241	133	310	D-lactate dehydrogenase [cytochrome]
PRK11230	PRK11230	4.76e-06	11	240	17	232	glycolate oxidase subunit GlcD; Provisional
TIGR01676	GLDHase	6.83e-04	36	144	37	148	galactonolactone dehydrogenase. This model represents L-Galactono-gamma-lactone dehydrogenase (EC 1.3.2.3). This enzyme catalyzes the final step in ascorbic acid biosynthesis in higher plants. This protein is homologous to ascorbic acid biosynthesis enzymes of other species: L-gulono-gamma-lactone oxidase in rat and L-galactono-gamma-lactone oxidase in yeast. All three covalently bind the cofactor FAD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17285.1	1.85e-106	2	536	50	577
QQK43172.1	2.40e-103	1	532	16	556
CAP97133.1	2.44e-103	2	536	50	577
BCS28228.1	5.28e-102	2	536	50	577
CAA75722.1	4.85e-101	1	532	10	550

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FXD_A	7.12e-106	3	536	5	522	Crystalstructure of eugenol oxidase in complex with isoeugenol [Rhodococcus jostii RHA1],5FXD_B Crystal structure of eugenol oxidase in complex with isoeugenol [Rhodococcus jostii RHA1],5FXE_A Crystal structure of eugenol oxidase in complex with coniferyl alcohol [Rhodococcus jostii RHA1],5FXE_B Crystal structure of eugenol oxidase in complex with coniferyl alcohol [Rhodococcus jostii RHA1],5FXF_A Crystal structure of eugenol oxidase in complex with benzoate [Rhodococcus jostii RHA1],5FXF_B Crystal structure of eugenol oxidase in complex with benzoate [Rhodococcus jostii RHA1],5FXP_A Crystal structure of eugenol oxidase in complex with vanillin [Rhodococcus jostii RHA1],5FXP_B Crystal structure of eugenol oxidase in complex with vanillin [Rhodococcus jostii RHA1]
1W1K_A	1.61e-103	1	532	10	550	STRUCTUREOF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum],1W1K_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum]
1W1J_A	6.34e-103	1	532	10	550	STRUCTUREOF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: The505Ser Mutant [Penicillium simplicissimum],1W1J_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: The505Ser Mutant [Penicillium simplicissimum]
1W1L_A	8.93e-103	1	532	10	550	STRUCTUREOF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Phe454Tyr Mutant [Penicillium simplicissimum],1W1L_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Phe454Tyr Mutant [Penicillium simplicissimum]
1AHU_A	8.93e-103	1	532	10	550	StructureOf The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHU_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHV_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHV_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHZ_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1AHZ_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],1VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],2VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum],2VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P56216	4.89e-102	1	532	10	550	Vanillyl-alcohol oxidase OS=Penicillium simplicissimum OX=69488 GN=VAOA PE=1 SV=1
P09788	5.25e-93	2	530	8	515	4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida OX=303 GN=pchF PE=1 SV=3
P94535	2.10e-18	58	240	45	218	Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) OX=224308 GN=glcD PE=3 SV=1
D4MUV9	3.59e-14	62	259	56	243	D-lactate dehydrogenase OS=Anaerostipes hadrus OX=649756 GN=CL2_23160 PE=1 SV=1
A4VGK4	1.43e-13	40	278	27	253	D-2-hydroxyglutarate dehydrogenase OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=d2hgdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001348_00812.