CAZyme Information: MGYG000001349_01005

Basic Information

• Species: Veillonella parvula_A
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella parvula_A
• CAZyme ID: MGYG000001349_01005
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546	MGYG000001349_9|CGC5	62517.94	8.8809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001349	2169789	Isolate	not provided	not provided

• Gene Location: Start: 553950; End: 555590 Strand: -

Full Sequence      

MINNHMLRIGALFLLTVLSYGFYNAYLPITDPVESNYVLSAITMLKHNSWISPMIYDHVW
YDKPPLTYWALMITYKLFGISDFTSRIPNTLVAGASVALMYHIIYRISKNTFASVLCAIL
LMSTLQFWYISHAIITDGFLFLFTLAIFGYSYLAFTNNDKSAMVKAYIAAALAVITKGPI
GIILPGLILLIYICARYAIHRKDERYQLLKDIKLLFNPLGLLGFIAIASPWYIAMYSIHG
EQFISGFLGLHNVDRALVSEHPKFNVWYYYLLIVPLSLLPWTPLTVYHLKDIDWKDEFDL
LGIIWFIVIVLFYSLVATKYLTYTLPAIIPCIIWAAIKICELITDKETGEFTQSFKKFNY
VVTLPLCIYYLIFTFATAFDKSLDSKPLIIGSFIIVCMILIGRYYITSFFKLAIYALVPL
ITLYSAITITVPPILFNQSGLQFKTFIEDTSKPIYIYGSYYTSIVYYMDTTPTQVFVDTT
DDSIWTEGKTLMPTITKETFLSNTSNNRGSYVIVPKKYDKDFSNALPYPKAKLVNKTKLA
SIYKLQ

Enzyme Prediction     

No EC number prediction in MGYG000001349_01005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	8	467	4.4e-78	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	8.16e-33	6	343	7	340	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.80e-11	44	330	43	324	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.59e-07	62	177	1	115	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQB17357.1	0.0	1	546	1	546
SNV00837.1	0.0	1	546	1	546
ACZ25181.1	0.0	1	546	1	546
CAB1276937.1	0.0	1	546	1	546
VEG94157.1	8.07e-259	1	546	1	538

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.13e-10	29	328	54	353	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.91e-25	6	327	1	309	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	8.91e-22	12	328	5	299	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
B4EUL1	2.80e-18	31	342	33	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
Q7N3Q9	4.71e-16	1	330	1	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
B4ETL9	2.45e-14	1	326	1	323	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
83	105
112	129
133	155
168	199
214	236
266	288
303	337
358	378
388	407
414	436