CAZyme Information: MGYG000001350_02250

Basic Information

• Species: Fusobacterium periodonticum_B
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium periodonticum_B
• CAZyme ID: MGYG000001350_02250
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235		27111.27	9.46

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001350	2454675	Isolate	not provided	not provided

• Gene Location: Start: 158302; End: 159009 Strand: -

Full Sequence      

MKKYLLAVVFLCLSILSYSNDTEALDQDTNTGIITQAKDFAKVKGKSKKQIFIDTLIPTI
EKVRNKIAEDKEYVKTLIEKEILTAEEKLYLEEMYTKYKVKSKSKTELVHKMVVPPTSFI
LGQASLESGWGNSKLAKEGNNLFAVRSSLKDPEKTVYLGPNQYYKRYESLEESLMDYVMT
LSRHSSYSNLRKAINNGEETIVLIKHLGNYSEMKNLYEQRLTQIITKNNLFKYDN

Enzyme Prediction     

No EC number prediction in MGYG000001350_02250.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	116	230	2.5e-22	0.8828125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2992	Bax	1.05e-76	30	235	43	261	Uncharacterized FlgJ-related protein [General function prediction only].
PRK10356	PRK10356	1.34e-22	17	228	44	266	protein bax.
COG1705	FlgJ	1.28e-15	116	235	64	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	8.01e-13	114	177	13	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12713	flgJ	1.79e-08	116	227	202	325	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGM22778.1	2.03e-140	1	234	1	234
EEO43385.2	2.03e-140	1	234	1	234
QYR65808.1	2.03e-140	1	234	1	234
QYR63900.1	2.03e-140	1	234	1	234
QYR67209.1	2.03e-140	1	234	1	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	6.28e-06	116	225	24	145	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	7.58e-06	116	225	24	145	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27297	1.19e-12	45	193	73	225	Protein bax OS=Escherichia coli (strain K12) OX=83333 GN=bax PE=4 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000209	0.999183	0.000174	0.000153	0.000146	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001350_02250.