CAZyme Information: MGYG000001351_00804

Basic Information

• Species: Edwardsiella tarda
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Edwardsiella; Edwardsiella tarda
• CAZyme ID: MGYG000001351_00804
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
174		19381.55	6.9505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001351	3631674	Isolate	not provided	not provided

• Gene Location: Start: 215160; End: 215684 Strand: +

Full Sequence      

MLLRQHYPDLQIVVPLVNARRRAQFERIKAEVAPDLTAHLLDGQARNAMYASDAALLASG
TAALECMLAKCPMVVAYRMKPFTFWLAQRLVKTEFVSLPNLLAGRELVPELLQHDCEPTR
LAQALTPLLADGAQSEALKQTFLQLHRQIRCGADEQAAEAVLALADRPRESMHE

Enzyme Prediction     

No EC number prediction in MGYG000001351_00804.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	150	2e-48	0.4011299435028249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.10e-83	2	169	213	379	lipid-A-disaccharide synthase; Reviewed
TIGR00215	lpxB	9.85e-69	2	164	218	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam02684	LpxB	9.75e-65	2	161	212	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
COG0763	LpxB	6.38e-64	2	167	215	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK01021	lpxB	1.46e-07	49	134	486	575	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKH89865.1	6.17e-115	1	174	221	394
ATI63515.1	6.17e-115	1	174	221	394
AOV97738.1	1.79e-104	1	174	221	394
QPR29379.1	1.79e-104	1	174	221	394
QPW31625.1	7.12e-103	1	174	216	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.19e-83	2	165	218	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.19e-83	2	165	218	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5F8U3	1.34e-84	2	165	218	381	Lipid-A-disaccharide synthase OS=Salmonella agona (strain SL483) OX=454166 GN=lpxB PE=3 SV=1
B5RHG7	5.40e-84	2	165	218	381	Lipid-A-disaccharide synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=lpxB PE=3 SV=1
C0Q6K5	5.40e-84	2	165	218	381	Lipid-A-disaccharide synthase OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=lpxB PE=3 SV=1
B5FJ29	5.40e-84	2	165	218	381	Lipid-A-disaccharide synthase OS=Salmonella dublin (strain CT_02021853) OX=439851 GN=lpxB PE=3 SV=1
B4TYE2	5.40e-84	2	165	218	381	Lipid-A-disaccharide synthase OS=Salmonella schwarzengrund (strain CVM19633) OX=439843 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001351_00804.