CAZyme Information: MGYG000001351_01493

Basic Information

• Species: Edwardsiella tarda
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Edwardsiella; Edwardsiella tarda
• CAZyme ID: MGYG000001351_01493
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218	MGYG000001351_83|CGC10	23983.63	10.2721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001351	3631674	Isolate	not provided	not provided

• Gene Location: Start: 974120; End: 974776 Strand: +

Full Sequence      

MKIRLGCLLAVLLLAGCAKQHTSTPAKVTLNQHSGGFLRDSADMDLADDSEFASYIRSAA
NTYNVDETLIKAIIQVESGGNPRAVSRSNAIGLMQLKASTAGRDAYRKKGRYGQPTTREL
KDPAVNIDLGTAYLNILKNQQLAGITNPETMRYAMIVAYANGAGAMLRTFARDRDVAIAK
INRMTPEQFCQYIRKKHPAAQAPRYLWKVNNAYLAMAR

Enzyme Prediction     

No EC number prediction in MGYG000001351_01493.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	67	215	1.1e-18	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	7.95e-87	54	213	1	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	4.96e-75	59	216	46	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	3.08e-70	55	212	195	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	5.23e-32	56	181	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	2.09e-27	54	212	141	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKH89266.1	8.74e-154	1	218	1	218
ATI62892.1	8.74e-154	1	218	1	218
AOV97110.1	6.61e-149	1	218	1	218
QPR27048.1	6.61e-149	1	218	1	218
AKR79382.1	4.11e-143	1	218	1	218

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	4.34e-61	57	216	27	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	5.76e-61	57	216	44	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	1.24e-60	57	216	27	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	1.24e-60	57	216	27	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	1.24e-60	57	216	27	186	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7LSJ1	4.81e-62	57	212	44	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=emtA PE=3 SV=1
A7MKC3	1.94e-61	59	216	46	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
P0C960	2.75e-61	1	216	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=emtA PE=1 SV=1
C4ZTN4	2.75e-61	1	216	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=emtA PE=3 SV=1
B1XAN4	2.75e-61	1	216	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12 / DH10B) OX=316385 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001351_01493.