CAZyme Information: MGYG000001352_00589

Basic Information

• Species: Clostridium_AQ sp000165065
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Clostridium_AQ; Clostridium_AQ sp000165065
• CAZyme ID: MGYG000001352_00589
• CAZy Family: GH38
• CAZyme Description: Mannosylglycerate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
990	MGYG000001352_2|CGC1	114455.56	6.0935

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001352	4458401	Isolate	not provided	not provided

• Gene Location: Start: 62833; End: 65805 Strand: -

Full Sequence      

MKKTAHCIHHTHWDLIWYFTAQDATVQLCYNMKEMLEGFRNGRITDFFFDGQSAPIDEYI
KLHPEDEEYIQSLVKEKKLMIGPFHSQLDCFICNGESVINNLRLGMQSANRLGYTSRVAY
LPDSFGHSWDFPKIFHQFGIKDFVITRGVGDEYDLNSEFYMKSNDGSEILVCTMIAGYGY
GCYAFRNGTLFNESALDYNKISVKSLMERLLSYSTLDEEFVFPLGFDQNPAMLDIPKRIE
AYNSNQNEIEFVSTTWQDFCNRVRKHGKSLKYHEGELFSTQYHRVHRSIFSARADIKALQ
DACERTITYGLQPLMSMLDAQGIPYNHGLIDSIWDKLLRCQTHSSATLTDETNDYIEQQT
KDAYHLITSNIVFLMKLLSISTQHSKEGYPLLVCNTLPYTRTLKIHTRVQTARADFRIVY
KGRELPYTLLSSEKKNCGVLRKDIRNMDPEGYFYDSDIMLSIEDVSGFSYQTLYIQDSDQ
PSFCFHLSSVSHIENERFRIHKDAEGIHILDRKSGKEHRKAIYLEESGDEGDSFDYSPPT
YDWILTDTFEDAEVTCKQSHDYSYMILTGIMKVPECLTSRKEKIKDSHLKYTIKLELTDQ
DNIHISGAIHNFAKDHRVRLVFRGNAPHTYSLAGTQYSYIKRESNPASLKKWKEECWFEE
PSPTWPLLNYVSVEDDEVMTVMTRSSKEYELIQEGTRDLAVVLFRSYGAMGYPDLHRRPG
RPSGLDYMVFQTPNCQMLKENSFDLAFTWYDTYDGNRIGNDYIAYACPQICFENQPFDKS
IHPISYFPTNPLAQTLPDNWSFLNIEKLEGCFGSLVKEEDYWLLRLYNNEIKPAQCGTIQ
SDEQLILSQTTLDHAFCKRISSKPEPLQKGELRMIQIQKSKRRRDFMKNIIGVCACPAGI
AHTYMAAENLERKGKKLGYSVKIETNGSGGVENRLSEEDIKSADYVIIAADTRVEMERFR
GKKLLEVSVTDAVRKVDTVYEKLNDSLKEY

Enzyme Prediction     

No EC number prediction in MGYG000001352_00589.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH38	5	269	1.4e-49	0.9442379182156134

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09819	PRK09819	9.07e-174	1	878	2	870	mannosylglycerate hydrolase.
cd10815	GH38N_AMII_EcMngB_like	5.16e-78	4	277	1	266	N-terminal catalytic domain of Escherichia coli alpha-mannosidase MngB and its bacterial homologs; glycoside hydrolase family 38 (GH38). The bacterial subfamily is represented by Escherichia coli alpha-mannosidase MngB, which is encoded by the mngB gene (previously called ybgG). MngB exhibits alpha-mannosidase activity that converts 2-O-(6-phospho-alpha-mannosyl)-D-glycerate to mannose-6-phosphate and glycerate in the pathway which enables use of mannosyl-D-glycerate as a sole carbon source. A divalent metal ion is required for its activity.
cd10814	GH38N_AMII_SpGH38_like	3.46e-57	4	281	1	271	N-terminal catalytic domain of SPGH38, a putative alpha-mannosidase of Streptococcus pyogenes, and its prokaryotic homologs; glycoside hydrolase family 38 (GH38). The subfamily is represented by SpGH38 of Streptococcus pyogenes, which has been assigned as a putative alpha-mannosidase, and is encoded by ORF spy1604. SpGH38 appears to exist as an elongated dimer and display alpha-1,3 mannosidase activity. It is active on disaccharides and some aryl glycosides. SpGH38 can also effectively deglycosylate human N-glycans in vitro. A divalent metal ion, such as a zinc ion, is required for its activity. SpGH38 is inhibited by swainsonine. The absence of any secretion signal peptide suggests that SpGH38 may be intracellular.
COG1445	FrwB	2.35e-45	887	982	1	97	Phosphotransferase system fructose-specific component IIB [Carbohydrate transport and metabolism].
cd05569	PTS_IIB_fructose	8.32e-45	890	982	1	93	PTS_IIB_fructose: subunit IIB of enzyme II (EII) of the fructose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In this system, EII (also referred to as FruAB) is a fructose-specific permease made up of two proteins (FruA and FruB) each containing 3 domains. The FruA protein contains two tandem nonidentical IIB domains and a C-terminal IIC transmembrane domain. Both IIB domains of FruA are included in this alignment. The FruB protein (also referred to as diphosphoryl transfer protein) contains a IIA domain, a domain of unknown function, and an Hpr-like domain called FPr (fructose-inducible HPr). This familiy also includes the IIB domains of several fructose-like PTS permeases including the Frv permease encoded by the frvABXR operon, the Frw permease encoded by the frwACBD operon, the Frx permease encoded by the hrsA gene, and the Fry permease encoded by the fryABC (ypdDGH) operon. FruAB takes up exogenous fructose, releasing the 1-phosphate ester in to the cytoplasm in preparation for metabolism primarily via glycolysis. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include fructose, chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, and a sensory system with similarity to the bacterial bgl system.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASU19832.1	0.0	1	880	1	880
ANU67741.1	0.0	1	880	1	880
QQR24445.1	0.0	1	880	1	880
QIX07607.1	0.0	1	880	1	880
QJA00942.1	0.0	1	880	1	880

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KBP_A	3.52e-41	2	743	6	776	Thecrystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],5KBP_B The crystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
3LVT_A	2.95e-38	2	743	6	776	TheCrystal Structure of a Protein in the Glycosyl Hydrolase Family 38 from Enterococcus faecalis to 2.55A [Enterococcus faecalis V583]
2WYH_A	1.02e-34	3	747	26	806	Structureof the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYH_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYI_A Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS],2WYI_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS]
2R48_A	1.18e-26	890	990	5	106	Crystalstructure of the fructose specific IIB subunit of PTS system from Bacillus subtilis subsp. subtilis str. 168 [Bacillus subtilis subsp. subtilis str. 168]
2R4Q_A	9.15e-25	890	982	5	97	Thestructure of a domain of fruA from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54746	2.10e-98	6	853	8	847	Mannosylglycerate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mngB PE=1 SV=2
Q9KER1	7.77e-40	1	741	1	770	Putative mannosylglycerate hydrolase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=mngB PE=3 SV=2
P69817	2.69e-24	887	989	1	104	PTS system fructose-like EIIB component 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=frwB PE=3 SV=1
P69819	2.69e-24	887	989	1	104	PTS system fructose-like EIIB component 2 OS=Shigella flexneri OX=623 GN=frwB PE=3 SV=1
P69818	2.69e-24	887	989	1	104	PTS system fructose-like EIIB component 2 OS=Escherichia coli O157:H7 OX=83334 GN=frwB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001352_00589.