CAZyme Information: MGYG000001352_03978

Basic Information

• Species: Clostridium_AQ sp000165065
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Clostridium_AQ; Clostridium_AQ sp000165065
• CAZyme ID: MGYG000001352_03978
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	MGYG000001352_18|CGC1	55007.33	5.6229

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001352	4458401	Isolate	not provided	not provided

• Gene Location: Start: 45703; End: 47124 Strand: +

Full Sequence      

MNKFPDDFLWGAAAAANQCEGAWDVGGKGISIADIEMLPDEVDRKSITCFTHTREQAIQA
AQDRIHNYPRRRGIDFYHTYAEDLQLLKEIGLRCIRLSFSWARIFPKGDEEEPNEEGLQF
YDRLIKKIVRLGMVPVMTISHYDMPLQLVLTYGGWTSRKLIGFFERYCKVLFNRYHEDVP
YWIVFNQINSMDGWGEFASLGILKDSCSDMERAKYQAIHHQFIASARAKKCAQEIDPSIQ
IGVMLGDDSCYYETCDPENVLMNTQYMQMHIYFFSDTLIRGSYPGYALRYFEEHDIHIDM
EEEDMLLLSRYSSDFLAISYYRSKVTNKKCAHPIDNPYLTQSLWGWATDPKGLRNSLNLY
WDRYQKPIFIAENGLGALDRVEDGKIHDDYRINYLREHIQQVMEAVYDGVNVFGYASWSP
IDMVSASQGEMSKRYGYVYVDLDDKGKGSGARIRKDSFYWYQKVIATNGRDLK

Enzyme Prediction     

No EC number prediction in MGYG000001352_03978.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	469	6.7e-135	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	472	1	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	0.0	1	471	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	4.80e-177	4	472	6	477	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	7.27e-172	1	472	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	8.31e-153	3	472	5	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCT44163.1	8.29e-232	1	472	5	477
QJA04432.1	1.77e-228	4	472	8	476
QIX10756.1	2.91e-227	4	472	8	476
ASU20418.1	4.03e-205	4	472	8	482
ANU71095.1	4.03e-205	4	472	8	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.86e-159	3	472	7	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	3.86e-146	1	472	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.10e-145	1	472	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	7.22e-141	5	472	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3PN8_A	1.50e-140	2	472	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	2.17e-155	3	472	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	1.18e-148	1	473	1	463	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P11988	8.20e-148	1	473	1	463	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
P26206	1.68e-143	2	472	3	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P42973	2.66e-143	1	472	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001352_03978.