CAZyme Information: MGYG000001352_03980

Basic Information

• Species: Clostridium_AQ sp000165065
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Clostridium_AQ; Clostridium_AQ sp000165065
• CAZyme ID: MGYG000001352_03980
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000001352_18|CGC1	55805.19	4.9668

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001352	4458401	Isolate	not provided	not provided

• Gene Location: Start: 47751; End: 49196 Strand: +

Full Sequence      

MKQVPETFPENFLWGGAFAACQCEGEYDKDGRGLSTSDIHEYTKGLNRAHIEKEGGGTLA
EIKRKAADTKGYYPKRYGIDFYHTYKDDLALLQEMGFKCFRTSISWSRIFPNGDETEPNE
AGLKFYDHLIDEIIKDGMEPIITMSHYDIPLHLVTEYGGFGNRKVIDFFVNYGKVLVERF
KGRVKYWIVCNQVNLIPTVQFGSLGIYDDQAENMEELMYQAAHNQFVACAKIKEIGHQID
PHAVFGTMLADCTFYPATCRPKDVVLTMKKNRMQYFFSDVQLRGEYPVYALRYFKERNIC
IHMEEGDEDVIRNNPMEFLAISYYYSRVVDSDKNDMTPMQAEQNPNLEPTPWEWRMDPLG
FYNCLSQYWDRYQVPLMIGENGFGALDTVEADESIHDPYRIDFLRKHIEQLKECIKDGVD
IFAYCAWGPIDIVSSSSAEMSKRYGFVYVDRDDLGNGTQKRMKKDSFYWYRDVIASNGEK
L

Enzyme Prediction     

No EC number prediction in MGYG000001352_03980.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	478	3.7e-137	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	7	481	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	7	479	3	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	0.0	7	481	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	1.25e-178	7	481	5	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	6.12e-168	1	481	1	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSI27480.1	0.0	1	481	1	481
QQR27975.1	0.0	1	481	1	481
ASU19437.1	0.0	1	481	1	481
ANU68130.1	0.0	1	481	1	481
QJA01296.1	0.0	1	481	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	6.67e-172	1	481	1	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	9.60e-162	9	481	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.73e-161	9	481	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.66e-157	9	481	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
2XHY_A	1.05e-155	7	481	7	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	9.04e-167	1	481	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	5.47e-163	7	481	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P24240	1.30e-157	7	481	3	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46829	5.73e-155	7	481	7	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q48409	7.95e-154	6	481	2	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001352_03980.