CAZyme Information: MGYG000001354_00608

Basic Information

• Species: Bifidobacterium dentium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium dentium
• CAZyme ID: MGYG000001354_00608
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
903	MGYG000001354_1|CGC13	99999.86	4.4071

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001354	2642081	Isolate	not provided	not provided

• Gene Location: Start: 698704; End: 701415 Strand: -

Full Sequence      

MTHTPSTFAPLADGWTLTAVNIEAAPESLREALAAGIPATVPGEATLDLLNAGLIADPFD
GANENDQQWIGDVDWRFTCRFDWHDNGADRHDLVAYGLDTIADVALNGRPVASTRNFHRS
YRWDVRDLLREGSNELTVTFTSPVRESDRMEQARGYYPHTEHHAFNQIRKPSYSFGWDWG
IDVANAGIWREIGIDSWSGVCIASVRPLVDVAADGTGLLNVHVEIERAGKGRIMSPYECH
SVRAAVPVHVGLSGFGADVAADGVVAEGRNETVLTLAVPEAKLWWPIGYGDQPLYDVAVA
AGDSAEAAWNGHVGFRTVHVDTRADNVGRPFQIYVNDVPVHAHGYNWIPDDAFIARVAER
DYERGIRDLVESNSNMVRAWGGGIYESDEFYDLCDRNGIMVWQDFMLACAAYPEDAETKA
EVEAEAREHITRLSEHASLIVWNGSNENYVAYSEWGGYKQALRDDDLPANEYGYGEKPWG
DYYYAELFPALLAELDPGRSAYLPSSPMSFTKFVGANFDTDGTMHIWDAWNRADYTVYAQ
YTPRFADEFGYQAPPAWSTLTGAVHDDELEPFGKQMLVHQKASGGNYKLARGMRSHITPG
HLDDVSFGGVVNGKPSDGEHSWLIPTDNWADIEDWHWACQLQQAQAMRFGVEHMRSLEPV
NAGALIWQLNDDWPVVSWAAVDFNGQRKPLWYASRDFFAPRLATIQPRVSEEYRETHSWE
GVRTANDHYELIVLNDTREAWKGSWKVERMTLAGEVLASQTFDVELDAVSHVGLPLAEEI
VDYADAGNELVVATASDGAFARVIFNPAEVIGQKLAAPAEAFGTVASRVDGGVELKVTAT
SYVRDLFCMADKIDAKASVDAGMVSLLPGESVTLRIDTGSDDDPQSFAAANVLRSANDLK
REW

Enzyme Prediction     

No EC number prediction in MGYG000001354_00608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	9	779	2.5e-89	0.6954787234042553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.09e-64	36	711	29	649	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.93e-06	313	447	315	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	1.55e-05	332	452	7	140	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	0.001	727	770	1	44	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
cd00464	SK	0.002	360	402	55	97	Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB08813.1	0.0	1	903	1	903
VEG22787.1	0.0	1	903	1	903
BAQ26112.1	0.0	1	903	1	903
QTL79856.1	0.0	1	903	1	903
QTL77966.1	0.0	1	903	1	903

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.34e-117	7	876	4	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.37e-117	7	876	4	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	9.48e-117	7	876	2	830	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	9.70e-117	7	876	4	832	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	3.32e-108	37	702	26	655	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	1.41e-84	40	719	31	667	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q2TXB7	6.85e-83	10	744	8	695	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	9.46e-83	10	744	8	695	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q4WAH4	6.27e-81	10	744	8	695	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	2.26e-80	10	744	8	695	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001354_00608.