CAZyme Information: MGYG000001354_01291

Basic Information

• Species: Bifidobacterium dentium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium dentium
• CAZyme ID: MGYG000001354_01291
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708	MGYG000001354_1|CGC32	78923.37	4.6055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001354	2642081	Isolate	not provided	not provided

• Gene Location: Start: 1590144; End: 1592270 Strand: +

Full Sequence      

MSRNSVDHILFGAAYYDEYLMMKGIDRIDEDMRMMKDAGLNVIRIAESTWSTCEPQPGKF
DFTYVDRALDAAQRAGIDVIVGTPTYAVPGWLVKLDPSVLAVTPNGEGKYGARQIMNIVN
ATYRFYGERVIRRLISHVADHPAVIGYQVDNETKYYDSVSDDMQRLFVKYLYEKFDGDLD
EMNHHFGLDYWSNRVDSWEDFPDVTATINESLGGEFDKFRRDQVRAFLQWQADIVREYAH
DNQFITHNFDFEWRGYSFGVQPAVDHFKASTAVDITGVDIYHPTEDDLTGKEIAFGGDMT
RSTKDGRNYLVLETEAQGQHGWVPFPGQLRLQAYSHLASGADMVEYWHWHSIHNSFETYW
KGLLSHDLEPNPTYREAGVFGREIAKPEVGERLVHLKKRNKVAIMVSNESLSALDWFLIE
SGFPFGGGLKYNDVVRNVYDALFELNVECDFIPSDADAERLARYGMIVTPALYCTGQKTT
DRLRKFVENGGHLVSTMRSFVSDDEVSVWADRAPHNLTDVFGMTYNQFTRPNGHVSVEFA
GALEGVPSTQALSLIELVTPADGTEVLATYGHYAWKDYAAVTRNTFGKGSAEWIATLLDA
ESIRAVMREAVEYAGVAGAGTALAGRIAVRQGTNTQGETVTYLLNYSASDVTIASPVPGE
VVVAPVVIASEGEIDEVATADVALKAGDAVAIGDELTIGRWNVVVIVG

Enzyme Prediction     

No EC number prediction in MGYG000001354_01291.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	15	385	4.4e-116	0.9919137466307277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	6.28e-82	26	386	10	375	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	3.05e-65	1	666	8	665	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	4.96e-29	400	617	1	207	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	6.96e-19	402	514	1	104	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
COG2730	BglC	0.001	28	152	75	190	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB10275.1	0.0	1	708	1	708
BAQ27591.1	0.0	1	708	1	708
VEG24261.1	0.0	1	708	1	708
QTL79276.1	0.0	1	708	1	708
QTL78403.1	0.0	1	708	1	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XB7_A	0.0	1	708	1	695	GH42alpha-L-arabinopyranosidase from Bifidobacterium animalis subsp. lactis Bl-04 [Bifidobacterium animalis subsp. lactis],5XB7_B GH42 alpha-L-arabinopyranosidase from Bifidobacterium animalis subsp. lactis Bl-04 [Bifidobacterium animalis subsp. lactis],5XB7_C GH42 alpha-L-arabinopyranosidase from Bifidobacterium animalis subsp. lactis Bl-04 [Bifidobacterium animalis subsp. lactis],5XB7_D GH42 alpha-L-arabinopyranosidase from Bifidobacterium animalis subsp. lactis Bl-04 [Bifidobacterium animalis subsp. lactis],5XB7_E GH42 alpha-L-arabinopyranosidase from Bifidobacterium animalis subsp. lactis Bl-04 [Bifidobacterium animalis subsp. lactis],5XB7_F GH42 alpha-L-arabinopyranosidase from Bifidobacterium animalis subsp. lactis Bl-04 [Bifidobacterium animalis subsp. lactis]
3TTS_A	2.65e-55	28	616	25	607	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
6LVW_A	3.81e-50	12	616	4	613	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
5E9A_A	5.02e-47	4	656	34	680	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]
4UCF_A	4.32e-44	29	603	37	609	Crystalstructure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UCF_B Crystal structure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UCF_C Crystal structure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UZS_A Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17],4UZS_B Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17],4UZS_C Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9KI47	1.95e-57	1	653	1	644	Beta-galactosidase BgaA OS=Planococcus sp. (strain 'SOS Orange') OX=128803 GN=bgaA PE=1 SV=1
D9SM34	1.87e-56	12	601	4	576	Beta-galactosidase BgaA OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=bgaA PE=1 SV=1
Q09HN2	2.77e-54	29	616	27	608	Beta-galactosidase BgaP OS=Planococcus sp. (strain L4) OX=377621 GN=bgaP PE=1 SV=1
P19668	6.72e-54	30	609	25	589	Beta-galactosidase bgaB OS=Geobacillus kaustophilus OX=1462 GN=bgaB PE=1 SV=1
C9S0R2	4.43e-53	30	609	25	589	Beta-galactosidase BgaB OS=Geobacillus sp. (strain Y412MC61) OX=544556 GN=bgaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001354_01291.