CAZyme Information: MGYG000001354_01316

Basic Information

• Species: Bifidobacterium dentium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium dentium
• CAZyme ID: MGYG000001354_01316
• CAZy Family: GH3
• CAZyme Description: Exo-alpha-(1->6)-L-arabinopyranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	MGYG000001354_1|CGC34	80848.65	4.2857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001354	2642081	Isolate	not provided	not provided

• Gene Location: Start: 1623518; End: 1625764 Strand: +

Full Sequence      

MSESTYPEVNDLTLEEKASLTSGGDAWHLQGVEAKGIPGYMITDGPHGLRKSLASSTGET
DLNDSVPATCFPPAAGLSSSWNPELIHQVGEAMAEECIQEKVAVILGPGVNIKRNPLGGR
CFEYWSEDPYLAGHEAIGIVAGVQSKGIGTSLKHFAANNQETDRLRVSANISQRALREIY
FPAFEHIVKEAQPWTIMCSYNRINGVHSAQNHWLLTDVLRDEWGFEGIVMSDWGADHDRV
ASLNAGLNLEMPPSYTDDQIVYAARDGRIQPEQLDRMAQGMIDLVNKTRAAMSVEGYRFD
VDAHDEVAHQAAVESMVLLKNDDAILPVASDAKVAVIGEFARTPRYQGGGSSHITPTKMT
SFLDTLTARGVDAKFAPGFTLDLEPADAAMAADAVEVAKGADIVLMFLGLPEAAESEGFD
RETLDIPAKQVELLEAVAAENKNIVVVLSNGSVVSVAPWADNAKGILESWLLGQAGGPAL
ADVIFGNVSPSGKLAQTVPMDINDDPSMINWPGEEGHVDYGEGVFVGYRYYDTYDKAVDY
PFGYGLSYATFEVSDVKVAKTGANTASVSAVVKNTSDVDAAETVQVYVAPGKSAVARPIH
ELKGFRKVFLKAGESAEVSFDLDERAFAYWSEKFDDWHVESGEYAIEVGTSSRDIAGTGM
VELDGDGKAEPLTEWSTFGEWSDDPVGSKIVASVYAEGEAGNLPKMPDNDMMRMFLRSMP
INSMPMLMSEGGKKITAFMLDEYAKVTE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.37	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	252	1.4e-66	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.28e-95	69	655	118	757	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	2.33e-65	316	528	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
COG1472	BglX	5.71e-62	24	341	47	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.83e-59	9	623	57	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.74e-37	36	275	65	307	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ27566.1	0.0	1	748	1	748
VEG24236.1	0.0	1	748	1	748
ADB10249.1	0.0	1	748	1	748
QTL78425.1	0.0	1	748	1	748
QTL79253.1	0.0	1	748	1	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WAB_A	0.0	1	748	1	748	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
7MS2_A	4.01e-222	9	724	9	731	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.21e-131	9	655	8	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.85e-130	9	655	8	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	5.59e-122	9	655	10	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
F6C6C1	0.0	1	748	1	757	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	0.0	1	748	1	757	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P14002	1.55e-221	9	742	9	746	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
A7LXS8	4.44e-128	9	658	50	740	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P27034	1.05e-122	9	671	6	818	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999866	0.000190	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001354_01316.