CAZyme Information: MGYG000001356_00555

Basic Information

• Species: Lawsonibacter sp000177015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Lawsonibacter; Lawsonibacter sp000177015
• CAZyme ID: MGYG000001356_00555
• CAZy Family: GH136
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1438	MGYG000001356_1|CGC4	154193.14	4.1931

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001356	3197155	Isolate	not provided	not provided

• Gene Location: Start: 574576; End: 578892 Strand: +

Full Sequence      

MIRRRIGSLVVCAAMLFSTVFPTITARAEGDTLPQATGNTYYVSTLDGNDRNSGKSETEA
LYSLTALSQIDLQPGDRVLLERGSNFYNDFLHLRGVKGTQEAPIVIDAYGDSEAALPVIN
TNGQGIWYQDYGTALDNAQHVYRGYVSSSILLYDCEYIEISNIAMTNRNLDIDVEYNARS
MMNRTGVAVVAQNGGTLDHIYLKGLDIQDVQGNVQDKHMNNGGIYFTVFKPENEGSTGIA
RYNDVRIEDCYLKSVNRWGIALAYTAYHAKFPDSTISNEAAQTYGMTNVFIRNNYLEDVG
GDAITTMYCYRPVVEYNVANGAASQINAQDYKGEGTTGDKPFGCVAASVWPWKCKDAVFQ
YNEVYNTHNDGGWNGDGQAWDADWGDGTVYQYNYSHDNEGGCFMICLQHAYNSVFRYNIS
QNDSTGIIVAATNPNADIYNNTFYIKEGVPFVYTNSGSYGALDVKNNIIYYAGSTPKDEN
WRTGTCGYANNIFVNYNNVPAGTNNIQLSAAEGASLMVDPGKGGTGNAQGNALNTLNGYQ
LKEKSPAINAGTMVETPAFLFEMESQGVHAGQDFFGNSILGVVPDVGAHQYSKLTGLGST
KYQIQDFTISNVNGDTAETVLNNLIAPEGWSLTLTDAAGQTLTGSTKVPGGSKVIVEKGD
GSREVYTVAMNTQADILYTPFERQSNSIHVPDLTKVNHLLDALELSWGASAKVMSGGVEQ
DRDVKLTSGMILQITSEDAATQNTLSIQVGPYSILESIETEDGQQGEIWYAQQRISAEET
NEAYVNMTRWNSSYKGWEGSSWAFVGADNGSNTTNIKIVDETDSRNGFGHVLGFRAPLDG
VISITGLEAVVNSETDNTGTIWASLTKNGVPLVEQQQISGGSGPVNFNQENIQVKAGDII
RFEVQNKGGTVPKANVMAPMVVTYTSISTETAPVITTTALKDGKENEAYSDTLQADSNTA
VRWSITAGSLPAGLTLDETSGVISGTPTAAGTATFTVTATNNAGSSEKEFTITVVAQTAK
YYTVTFESNGGTPVAQQTVEENGFAAQPPAPSRSGYIFTGWYLNAACTQEFDFAAAITKD
LTLYAGWRETGGGSGGGSSGGGNQTEITHNPDGSTTTTVTKPDGTVTETTVSSDGGKTVV
ETKPDGNMTTTITQPDGSSSVTKVDETGKWESEIKVPEKVVDAAEEKEEKVTLPLPGVPN
TSDLDSAPTITVQLPKGKSVLVEIPVDDVTSGTVAVLVKEDGTEEVIKTTVTTENGVAVT
LTDDQSVKIVDNSKDFSDVPNSYWGAEAIDFASSRELFGGTSPNTFSTEVVMTRGMMVTV
LASLEGVDTSTGSVWYEAGQKWAMEEGISDGTNMDQGMTREQLALMLYRYAGSPAVSGDV
DAFADKDSISSWATQAMVWAVQEGLISGVGDNTLNPQGQATRAQVATILMRFIENSVK

Enzyme Prediction     

EC	3.2.1.140

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH136	38	589	2.4e-147	0.9938900203665988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09479	Flg_new	2.91e-18	1022	1085	1	64	Listeria-Bacteroides repeat domain (List_Bact_rpt). This model describes a conserved core region of about 43 residues, which occurs in at least two families of tandem repeats. These include 78-residue repeats which occur from 2 to 15 times in some proteins of Bacteroides forsythus ATCC 43037, and 70-residue repeats found in families of internalins of Listeria species. Single copies are found in proteins of Fibrobacter succinogenes, Geobacter sulfurreducens, and a few other bacteria.
pfam05345	He_PIG	2.09e-11	932	1014	1	94	Putative Ig domain. This alignment represents the conserved core region of ~90 residue repeat found in several haemagglutinins and other cell surface proteins. Sequence similarities to (pfam02494) and (pfam00801) suggest an Ig-like fold (personal obs:C. Yeats). So this family may be similar in function to the (pfam02639) and (pfam02638) domains. This domain is also found in the WisP family of proteins of Tropheryma whipplei.
NF033189	internalin_A	1.48e-07	1022	1138	567	670	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.
pfam00395	SLH	3.05e-07	1383	1425	1	42	S-layer homology domain.
NF033189	internalin_A	7.22e-07	1012	1138	626	749	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT93619.1	3.46e-154	11	593	11	582
ARV05068.1	2.41e-144	38	593	34	581
ERK42296.1	4.94e-134	38	469	242	663
QOL32965.1	3.65e-132	41	581	3	546
QNM03227.1	1.40e-131	40	469	7	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V6M_A	6.69e-159	38	594	8	580	ChainA, Fibronectin type III domain-containing protein [Tyzzerella nexilis]
6KQT_A	1.92e-135	38	469	244	665	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - native protein [Eubacterium ramulus ATCC 29099]
6KQS_A	1.00e-131	38	469	244	665	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - selenomethionine derivative [Eubacterium ramulus ATCC 29099]
5GQC_A	3.19e-125	36	588	15	594	Crystalstructure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_C Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_D Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_E Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_F Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_G Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_H Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQF_A Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, lacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQF_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, lacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQG_A Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, galacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQG_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, galacto-N-biose complex [Bifidobacterium longum subsp. longum]
7V6I_A	2.45e-123	38	588	13	606	ChainA, Lacto-N-biosidase [Bifidobacterium saguini DSM 23967]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	7.77e-08	1274	1436	1680	1858	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P0DJ98	9.70e-08	1022	1087	83	149	Putative membrane protein Bcell_0381 OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=Bcell_0381 PE=4 SV=1
P0DJ97	1.10e-07	1022	1087	663	729	Putative Gly-rich membrane protein Bcell_0380 OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=Bcell_0380 PE=4 SV=1
P38535	1.19e-07	1269	1436	901	1084	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001179	0.997612	0.000253	0.000388	0.000285	0.000250

TMHMM  Annotations     

start	end
7	26