CAZyme Information: MGYG000001357_00439

Basic Information

• Species: Helicobacter pylori_C
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter; Helicobacter pylori_C
• CAZyme ID: MGYG000001357_00439
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000001357_1|CGC2	39688.08	8.2564

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001357	1566655	Isolate	not provided	not provided

• Gene Location: Start: 434046; End: 435065 Strand: -

Full Sequence      

MVEGLSPENVAKLEETIAPFSAFSSIEFLDITDEELEPRHNYRKLDPLIAGEIKKLYLKL
NSFSQKRFSKMIMCRFFFASLFPQYDKMIMFDVDTLFVGDISESFFIPLDDHYFGAVREK
DLIAMDRNSAKDLYELRQMHSKSIGVADAFPNLKEAQILFDNYFNAGFLALNLKSWRKEN
LENQLMGFFLVKNEKLLFPDQDALCFVCRGRILELPYSYNAHPSFLDTPSFPSVKEARML
HFWGDKPWKLFSVIGAKKWHEALIQTPFKDAYFNAPFLDHLFESLQNKDKEIHALNKILS
FSDKRHSFESLLPRLSSKLLIEFLLFKAKQKVKRLIRRV

Enzyme Prediction     

No EC number prediction in MGYG000001357_00439.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	1	249	1.8e-53	0.7354085603112841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1442	RfaJ	6.47e-68	2	338	39	324	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd04194	GT8_A4GalT_like	5.21e-44	3	249	38	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	5.93e-31	42	248	54	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	8.53e-07	75	250	86	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
PRK15171	PRK15171	2.00e-05	64	277	99	291	lipopolysaccharide 3-alpha-galactosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU40585.1	9.64e-248	1	339	1	339
BAW65254.1	1.21e-241	1	339	1	339
BAW54274.1	1.71e-241	1	339	1	339
BAW49670.1	1.41e-240	1	339	1	339
BBK69218.1	2.84e-240	1	339	1	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	1.07e-13	64	269	378	589	ChainA, WbbM protein [Klebsiella pneumoniae]
3TZT_A	7.58e-06	145	249	137	253	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27129	2.07e-09	76	270	114	295	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P43974	2.06e-08	86	227	134	252	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
P25148	3.17e-06	4	274	46	269	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001357_00439.