CAZyme Information: MGYG000001357_00716

Basic Information

• Species: Helicobacter pylori_C
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter; Helicobacter pylori_C
• CAZyme ID: MGYG000001357_00716
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		41511.65	9.4994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001357	1566655	Isolate	not provided	not provided

• Gene Location: Start: 707808; End: 708890 Strand: +

Full Sequence      

MPTILVSALEASSNVHLEELRRNLPKDYRFIGVFEGKEALYSPREFSIMGFRDVIGRLGF
LLKAHKEMVQLAKQADMVLLMDSSSFNIPLAKKIKKQDPHKKIMYYILPQVWAWKKWRAK
SLEKYCDLLGAILPFEVGYYQKKAQYVGHPLLDEIKYYKKDIKGETLVFMPGSRKSEIAK
IFPLFVKTAQILEQNEGFKRRVLVVPSFFKGLDLKALYGEDIKLFEISYDTHKSLFEAEF
AFICSGTATLEAALIGTPFVLAYRAKTMDFLIARMLVNLHYIGLANIFYNALNNETPGLG
ESQLHPELIQHFLSVENLLKAYEEMDRERYFKESLRLREYLASGSARKIANEMAFLLNLT

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	328	9.2e-97	0.940677966101695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	2	355	6	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	0.0	1	356	1	347	lipid-A-disaccharide synthase.
pfam02684	LpxB	5.52e-155	4	350	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
COG0763	LpxB	2.64e-135	1	360	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	4.52e-70	1	358	1	376	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU40849.1	9.47e-261	1	360	1	360
BBK69486.1	5.48e-260	1	360	1	360
BAW48680.1	2.23e-259	1	360	1	360
BAW65525.1	3.17e-259	1	360	1	360
BAW36176.1	9.08e-259	1	360	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.05e-28	3	287	8	317	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.44e-28	3	287	8	317	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2USW3	1.01e-256	1	360	1	360	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain Shi470) OX=512562 GN=lpxB PE=3 SV=1
B6JM91	1.17e-255	1	360	1	360	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain P12) OX=570508 GN=lpxB PE=3 SV=1
Q1CT05	1.67e-255	1	360	1	360	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain HPAG1) OX=357544 GN=lpxB PE=3 SV=1
Q9ZKY2	4.58e-253	1	360	1	360	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=lpxB PE=3 SV=1
B5Z7M7	1.87e-252	1	360	1	360	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain G27) OX=563041 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001357_00716.