CAZyme Information: MGYG000001357_00777

Basic Information

• Species: Helicobacter pylori_C
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter; Helicobacter pylori_C
• CAZyme ID: MGYG000001357_00777
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280		32593.09	8.6101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001357	1566655	Isolate	not provided	not provided

• Gene Location: Start: 766473; End: 767315 Strand: +

Full Sequence      

MRVFIIHLSPKTCQNFSLKETHITPLLESLKLQGISYEIFDAIYSKISPTQLHPLILEHL
HSSFMIEDLWAFCKNEKHPPCTLKNFFYALKHCGKRMGFGELGCYASHYSLWQKCIELNE
AICILEDDIIVKEHFKESLEFCYQHINELGYIRLMHLEENVAKQKTPIKGVSQILNFKDG
IGTQGYVLAPKAAQKLLKYSAKEWVMPIDCVMDRHYWHGVKNYVLEEFAIACDGMNTQNS
NTEKQRPKKLPLSIRIGRFLHKSTIKILDKVFRYSSKINH

Enzyme Prediction     

No EC number prediction in MGYG000001357_00777.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	3	212	1.6e-42	0.9779005524861878

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3306	COG3306	6.13e-67	17	279	1	255	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
pfam01755	Glyco_transf_25	5.89e-48	22	212	18	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
cd06532	Glyco_transf_25	2.38e-27	2	212	1	128	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU40911.1	1.60e-214	1	280	1	280
BAW56456.1	2.10e-210	1	280	1	280
BAW73354.1	4.23e-210	1	280	1	280
BAW40845.1	1.21e-209	1	280	1	280
BAW65586.1	1.72e-209	1	280	1	280

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0JPH3	1.01e-09	3	209	332	511	Procollagen galactosyltransferase 1-A OS=Xenopus laevis OX=8355 GN=colgalt1-a PE=2 SV=1
Q17FB8	4.35e-09	88	209	378	502	Glycosyltransferase 25 family member OS=Aedes aegypti OX=7159 GN=AAEL003481 PE=3 SV=1
A5PMF6	1.05e-08	88	224	378	520	Procollagen galactosyltransferase 1 OS=Danio rerio OX=7955 GN=colgalt1 PE=3 SV=1
Q5U483	1.88e-08	94	209	391	511	Procollagen galactosyltransferase 1-B OS=Xenopus laevis OX=8355 GN=colgalt1-b PE=2 SV=1
Q8IYK4	1.90e-08	100	209	409	523	Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001357_00777.