CAZyme Information: MGYG000001357_00961

Basic Information

• Species: Helicobacter pylori_C
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter; Helicobacter pylori_C
• CAZyme ID: MGYG000001357_00961
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		35426	6.9101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001357	1566655	Isolate	not provided	not provided

• Gene Location: Start: 956743; End: 957663 Strand: -

Full Sequence      

MRSPIYTEVEEADYTDYTEAEAPIENHEVTPPNPAQDTQQDLIIETQQNPKEPSEPCKIA
PPKISFNQVVFKKIKRKLNHFIGNILARTEVHKKLVAKYDDLTGKYDDLTGKYDDLTGKY
DDLTGKYDDLTGKYDDLTGKYDDLTGKYDDLTGKYESLLAKETNIKETFWERRVDSEKEA
FFLEHFYLTSVYVASTAGYYLTPKGAKTFIEATERFKIIEPVDMFINNPTYHGIANFTYV
PCPVSLNKHAFNSTIQNAKKPDISLKPPKKSYFDNLFYHQLNTRKCLRAFHKYSRRYAPL
KTPKEV

Enzyme Prediction     

No EC number prediction in MGYG000001357_00961.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3306	COG3306	3.26e-29	167	297	128	255	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
pfam01755	Glyco_transf_25	3.15e-07	184	226	160	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
pfam01576	Myosin_tail_1	8.45e-05	36	180	471	631	Myosin tail. The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.
cd06532	Glyco_transf_25	2.03e-04	170	226	75	128	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHN34746.1	3.92e-150	4	306	147	437
AGL66656.2	3.34e-149	4	306	146	428
AGR63192.1	4.23e-149	4	306	146	435
AGS15537.1	4.23e-149	4	306	146	435
BAW39365.1	4.42e-149	4	306	147	426

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999955	0.000072	0.000004	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001357_00961.